KEGG   Bacillus subtilis subsp. subtilis 168: BSU15350
Entry
BSU15350          CDS       T00010                                 

Symbol
ylmB
Name
(RefSeq) N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine deformylase
  KO
K20895  formylaminopyrimidine deformylase [EC:3.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU15350 (ylmB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BSU15350 (ylmB)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 940116
NCBI-ProteinID: NP_389418
Pasteur: BG13371
BSORF: BG13371
UniProt: O31724 A0A6M3ZAJ1
Position
1607556..1608836
AA seq 426 aa
MDQQIYSLQKKVEEHKEELIQLAKTLISYQTPAPPARNTEGIQSWIAGYLNELGFSIDKW
DVYPGDPNVVGKLKGTDSADYYSLIINGHVDVAEVKEDEEWKHDPFHPIEKNGLLIGRGA
SDMKGGMACVLFAVKLIREASIELPGDLILQSVIGEEVGEAGTLECCKRGYHADFAIVAD
TSDMHIQGQGGVITGWIEIKSSQTFHDGTRRNMIHAGGGTFGASAIEKMAKIIAGLGELE
RHWSIMKSYPGFKPGTNTINPAVIEGGRHAAFIADECRLWITVHFYPNETHDQVAAEIED
YVNRLSDSDIWLRENRPVFKWGGSSMIEDRGEIFPALEVDPGHPGVLALTASHQKVKREC
PIIDVSQSVTDGGWLYDAGIPCVIYGPGDLHNAHSVNEKVSIEQLVEYTKIILDFIISWC
SRKKEQ
NT seq 1281 nt   +upstreamnt  +downstreamnt
ttggatcaacaaatatactctttgcaaaaaaaagtggaagaacataaggaggagcttatt
cagcttgcgaaaacgctgatttcttatcaaacacctgctccgcctgcaagaaatacagag
ggcattcagtcttggattgcgggatatttaaatgaattgggattctcgatcgacaaatgg
gatgtgtaccctggagatcccaatgttgtagggaagctaaaaggaacagattcagcagat
tattatagcctgattatcaatggccatgtagatgtggcagaggtaaaagaggatgaagaa
tggaagcacgatccgtttcatcccattgaaaaaaacggtctcttaatcgggcgaggcgct
tccgatatgaagggcggaatggcttgtgtgctgtttgctgtcaaattaattcgtgaagca
agcattgaacttccaggtgatctgattctgcaatcggttattggggaggaagttggagag
gccggcacacttgaatgctgcaagaggggctaccacgctgattttgcaattgtcgcggat
acgagcgatatgcatattcaaggccaaggcggtgtcattacaggctggatcgaaatcaaa
agcagtcaaacatttcatgatggaacgagacggaatatgattcatgcaggcggaggaaca
ttcggagcaagcgcaattgaaaaaatggcaaaaatcattgcggggctcggtgaacttgag
cgccactggtctattatgaaaagttatcccggttttaaaccaggcacaaatacgattaac
ccggcagttatagaaggcggcagacatgcggcttttatagcggacgaatgccggctgtgg
atcacagtccatttttatccgaatgaaacccatgaccaagtggcagcggaaatagaagat
tacgtcaatcggctgagtgacagtgatatttggcttagggaaaaccgccctgtattcaag
tggggaggctcatctatgatagaagacaggggagaaatttttccggcattggaagttgac
cctggccacccaggcgtcttagcgctaactgcctctcatcagaaagtgaaacgggagtgt
ccaattattgacgtttctcaatcagttacagatggcggatggctgtatgatgccggtatt
ccatgcgtaatatacggtcctggagatctgcacaatgcacactctgtgaacgagaaggta
tcgattgagcagctagtagagtatacaaaaattatactcgattttatcatcagctggtgc
agccggaaaaaagaacaatga

DBGET integrated database retrieval system