KEGG   Bacillus subtilis subsp. subtilis 168: BSU15360
Entry
BSU15360          CDS       T00010                                 

Symbol
ylmC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PRC
Other DBs
NCBI-GeneID: 939682
NCBI-ProteinID: NP_389419
Pasteur: BG13372
BSORF: BG13372
UniProt: O31725 A0A6M4JIF5
Position
1608919..1609164
AA seq 81 aa
MISISEFQVKDVVNVSNGKKLGSIGDIDINVTTGKIQAIILGGNGKVLGFFGKEEELVIP
WRNIVKIGEDVILVRLSEPHA
NT seq 246 nt   +upstreamnt  +downstreamnt
atgatcagcatttcagaatttcaggtaaaggatgtcgtcaatgtctcaaacggaaaaaag
ctggggagtattggtgatattgatatcaatgtgaccactggaaaaattcaggcgatcata
ctcggaggaaatgggaaagttctcggattttttggaaaagaagaggaattggtcattcca
tggcgaaatatagtaaaaatcggggaagatgtaatcttagtccgattaagtgaaccacat
gcataa

DBGET integrated database retrieval system