KEGG   Bacillus subtilis subsp. subtilis 168: BSU15370
Entry
BSU15370          CDS       T00010                                 

Gene name
ylmD
Definition
(RefSeq) laccase domain protein YlmD
  KO
K05810  polyphenol oxidase [EC:1.10.3.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU15370 (ylmD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.-  
     BSU15370 (ylmD)
Motif
Pfam: Cu-oxidase_4
Other DBs
NCBI-GeneID: 939954
NCBI-ProteinID: NP_389420
Pasteur: BG13373
BSORF: BG13373
UniProt: O31726 A0A6M4JHX9
Position
1609327..1610163
AA seq 278 aa
MNTYHPFSLTTPSTLMIQDWAQTNQNNKEVIAGFTTKNGGVSQKPFESLNTGLHVHDKDA
DVVKNREYIADMFNTDLQSWVFADQTHDNRVQKVTQRDRGKGAREYHTALKATDGIYTNE
KNVFLALCFADCVPLFFYDPVKSLVGVAHAGWKGTVKQIGREMVKQWTEKEGSNPSDIYA
VIGPSISGACYTVDDRVMDAVRALPVSADLAANQTAKAQYQLDLKELNRLILMDSGLASE
QISVSGLCTESEPSLFYSHRRDQGKTGRMMSFIGMKEA
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaatacatatcacccattcagtcttaccacaccctcgacactcatgatacaagactgg
gctcaaacgaatcaaaacaacaaagaggtcattgccggatttacgacaaaaaacggcggt
gtcagccaaaagccttttgaatcgttaaatacaggattgcacgttcatgacaaagatgca
gatgtagttaaaaatcgtgaatatattgccgatatgtttaatactgatttgcagtcttgg
gtattcgctgatcagacacatgataatcgcgttcagaaagtgacgcagagggatagggga
aaaggcgcccgtgagtatcacacggctctaaaagcaacggacgggatctatacaaatgaa
aaaaatgtatttttagcattatgctttgctgattgtgtgcctcttttcttttatgatccg
gttaagtcgcttgtcggagtcgcccatgccgggtggaaaggcaccgtcaaacagattggc
agagaaatggtgaagcaatggactgagaaggaaggttcaaatccctcagatatttacgct
gttattggcccgtctatcagcggagcatgctatacggtagacgaccgcgtcatggatgct
gtccgcgcattgccggtttcagcagaccttgccgccaatcagacggcaaaggcacaatat
cagcttgatctgaaagagctgaaccgtcttatactgatggacagcggtttggcaagtgaa
caaatttctgtcagcggtttatgcacggaaagcgagccgtctcttttctattctcatcgc
cgcgatcaggggaaaactggacggatgatgtcctttatcggaatgaaggaggcataa

DBGET integrated database retrieval system