KEGG   Bacillus subtilis subsp. subtilis 168: BSU15380
Entry
BSU15380          CDS       T00010                                 

Symbol
ylmE
Name
(RefSeq) hypothetical protein
  KO
K06997  PLP dependent protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    BSU15380 (ylmE)
SSDB
Motif
Pfam: Ala_racemase_N FlgN NanE
Other DBs
NCBI-GeneID: 940117
NCBI-ProteinID: NP_389421
Pasteur: BG13374
BSORF: BG13374
UniProt: O31727 A0A6M3ZE36
Position
1610170..1610862
AA seq 230 aa
MRVVDNLRHINERINEACNRSGRSSDEVTVIAVTKYVSPERAQEAVDAGITCLGENRDAE
LLRKQELMKGNPEWHFIGSLQSRKAKSVVNSVSYIHSLDRLSLAKEIEKRAEGTVRCFVQ
VNTSLEPSKHGMKKEEVIPFIQELSGFEHILVAGLMTMAPLTDDQDQIRSCFRSLRELRD
QVQKLNQPNAPCTELSMGMSNDFEIAIEEGATYIRIGSSLVGNETGGVQQ
NT seq 693 nt   +upstreamnt  +downstreamnt
ttgcgtgttgttgataatttacgacatataaacgaacgaataaacgaagcatgtaacaga
tcgggccgcagctccgatgaagttacggttattgcagtcacaaaatatgtatcacctgaa
agagcacaggaggcagtagatgctggcatcacctgcctcggagagaatcgggatgcggaa
ctgctccgcaaacaggaattgatgaaagggaatccggaatggcattttatcggcagtctg
caatcaagaaaagcaaaatctgtcgtcaattcggtttcctatatccattccctagaccgg
ctctcattagcgaaagaaattgaaaaacgggctgaaggtactgtacgatgctttgtgcag
gtcaatacctctcttgagccttctaaacatggcatgaaaaaagaagaagtcattccattc
atacaggagctttccggtttcgaacatatccttgttgccgggctgatgacaatggctccg
ctgactgatgatcaagatcagatcagaagctgtttcaggtcgctgagagaactccgtgac
caggttcagaagctgaaccagccgaacgctccgtgtactgaactgtcgatgggcatgtca
aatgattttgaaattgcaattgaagaaggagctacttatattagaatcggctcatcgtta
gtcggaaatgaaacagggggtgtacagcaatga

DBGET integrated database retrieval system