KEGG   Bacillus subtilis subsp. subtilis 168: BSU15390
Entry
BSU15390          CDS       T00010                                 

Symbol
sepF
Name
(RefSeq) cell division machinery factor
  KO
K09772  cell division inhibitor SepF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15390 (sepF)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    BSU15390 (sepF)
SSDB
Motif
Pfam: SepF
Other DBs
NCBI-GeneID: 939952
NCBI-ProteinID: NP_389422
Pasteur: BG13375
BSORF: BG13375
UniProt: O31728 A0A6M4JGI1
Structure
PDB: 
3ZIH 3ZII

Position
1610865..1611314
AA seq 149 aa
MKNKLKNFFSMEDEEYEYEYIETERESHEEHEQKEKPAYNGNKPAGKQNVVSLQSVQKSS
KVVLSEPRVYAEAQEIADHLKNRRAVVVNLQRIQHDQAKRIVDFLSGTVYAIGGDIQRIG
SDIFLCTPDNVDVSGTISELISEDEHQRW
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaaaataaactgaaaaactttttctcaatggaagatgaagaatacgaatatgaatat
attgagacagagcgggaatctcatgaggagcatgagcaaaaagaaaagccggcttacaac
gggaataaacctgcgggcaaacagaatgtagtgagcttgcaaagtgttcagaaatcctct
aaagtggtgttgagtgagccgcgcgtttatgcggaggcgcaggaaatagccgaccatttg
aagaaccggcgggcagttgtcgtcaatcttcagcggatacagcatgaccaggcgaagcgg
attgttgactttttaagcggaaccgtttatgccattggcggcgatattcaaagaatcggc
tcagatattttcctctgcacgcctgacaacgtagatgtatcaggcacaatttctgagctc
atatctgaagacgaacatcagaggtggtaa

DBGET integrated database retrieval system