KEGG   Bacillus subtilis subsp. subtilis 168: BSU15400Help
Entry
BSU15400          CDS       T00010                                 

Gene name
ylmG
Definition
(RefSeq) hypothetical protein
  KO
K02221  YggT family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU15400 (ylmG)
Secretion system [BR:bsu02044]
 Type II secretion system
  Type IVa pilus homolog protein
   BSU15400 (ylmG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YGGT
Motif
Other DBs
NCBI-GeneID: 940008
NCBI-ProteinID: NP_389423
Pasteur: BG13376
BSORF: BG13376
UniProt: O31729
Position
1611321..1611593
Genome map
AA seq 90 aa AA seqDB search
MILYQVFSVLSLLITIYSFALIIYIFMSWVPSTRETAVGRFLASICEPYLEPFRKIIPPI
AMLDISPIVAILVLRFATTGLWGLYRMIAF
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgatcctttatcaagttttttcggttttaagcttattaatcacaatatactcatttgcc
ctgatcatatatatttttatgtcatgggtgccgagtacgagggaaacagcagtcgggcgt
tttttggcttcgatttgtgaaccatatctcgaaccattcagaaaaatcatccctccgatt
gcaatgctggatatttcaccaatcgtagcaatacttgtgcttcggtttgcgacaaccggc
ttgtggggactttatcgcatgattgcgttttaa

DBGET integrated database retrieval system