KEGG   Bacillus subtilis subsp. subtilis 168: BSU15410
Entry
BSU15410          CDS       T00010                                 

Symbol
ylmH
Name
(RefSeq) RNA-binding protein YlmH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YlmH_RBD S4 XisH RNA_pol_A_CTD
Other DBs
NCBI-GeneID: 940118
NCBI-ProteinID: NP_389424
Pasteur: BG11856
BSORF: BG11856
UniProt: P71020 A0A6M4JLM9
Position
1611654..1612427
AA seq 257 aa
MSDIYQHFRKDERAFIDQALEWKRIVQEQYRMKLTDFLDPREQVILSAVTGQADVGLAFS
GGYDRAERKRAILFPEYITPEESDFELQAFNVRYADKFVSVDHRSLLGALMGIGLKRQKF
GDIVFSETAVQLIVSADTADFVAAQLTQAGKAAVSLEKIDLSDLNIPAVDVEIRDDTVSS
LRLDAVCASMSRQSRQKSQTLVKNGLVKVNWKVVEDPSYIVAEGDMLSIRGFGRCSLTKI
EGKTKKDKWRVTFERQK
NT seq 774 nt   +upstreamnt  +downstreamnt
atgagcgatatatatcagcacttcagaaaagacgagcgggcctttattgatcaagcgctc
gaatggaaaagaattgtccaggagcagtaccggatgaagctgaccgactttttagatccc
cgagagcaggtcatcctctctgctgttacgggacaggcagatgtcgggcttgccttttcc
ggcggctatgacagagcggagcggaaacgggcgattctgtttccagagtacattactccg
gaagaatcagattttgaactgcaggcgtttaacgtccgttatgctgacaagtttgtctca
gtagatcatcgttctctgcttggtgcattaatgggcataggattaaagcggcaaaaattc
ggtgacatcgtgttttctgagacagcagtgcaattgattgtctcagccgataccgctgat
tttgtggctgcacagctgacccaagcaggcaaagcggcggtcagcctagagaaaatcgac
ttgtcagaccttaacattccagcagttgatgtcgaaataagagatgacacggtttcttct
ttaaggcttgacgccgtctgcgcctctatgagcaggcaatcccgccagaaatcacagacg
cttgtgaaaaacggccttgtgaaagtgaactggaaggtggttgaagatccttcatacata
gtcgcggaaggggacatgctgtctatcagaggttttggccggtgcagcttaacaaaaatc
gaaggaaaaaccaaaaaagacaaatggagagttacgtttgaacgacaaaaatag

DBGET integrated database retrieval system