KEGG   Bacillus subtilis subsp. subtilis 168: BSU15420
Entry
BSU15420          CDS       T00010                                 

Symbol
divIVA
Name
(RefSeq) septum site-determining protein DivIVA
  KO
K04074  cell division initiation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15420 (divIVA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    BSU15420 (divIVA)
SSDB
Motif
Pfam: DivIVA TRAF_BIRC3_bd DUF2087 vATP-synt_E DUF1664 DHR10 DAAD Prefoldin
Other DBs
NCBI-GeneID: 939972
NCBI-ProteinID: NP_389425
Pasteur: BG11835
BSORF: BG11835
UniProt: P71021 A0A6M4JG33
Structure
PDB: 
2WUJ 2WUK

Position
1612521..1613015
AA seq 164 aa
MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHF
ANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEE
LKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE
NT seq 495 nt   +upstreamnt  +downstreamnt
atgccattaacgccaaatgatattcacaacaagacgtttacaaaaagttttcgcggatat
gatgaagatgaagtaaatgaattcctagcccaagtcagaaaagattacgaaattgttctc
cgcaagaaaactgagcttgaagcgaaagtcaatgagcttgatgaaagaatcggacacttt
gccaatattgaggagacattgaataaatcaattttagttgctcaagaagcggctgaagac
gtaaaacgcaattctcaaaaagaagcaaagctgatcgttcgggaagcggagaaaaacgct
gatcgcattatcaacgaatcgttatcaaaatcaagaaaaattgcaatggaaattgaagag
ctgaaaaaacagtctaaagtgttcagaacacgtttccaaatgctgattgaagctcagctt
gatcttctgaaaaatgacgattgggatcatctccttgagtatgaagtcgacgctgtattt
gaggaaaaggaataa

DBGET integrated database retrieval system