KEGG   Bacillus subtilis subsp. subtilis 168: BSU15450Help
Entry
BSU15450          CDS       T00010                                 

Gene name
lspA
Definition
(RefSeq) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03060  Protein export
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU15450 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU15450 (lspA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     BSU15450 (lspA)
Peptidases [BR:bsu01002]
 Aspartic Peptidases
  Family A8: signal peptidase II family
   BSU15450 (lspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8
Motif
Other DBs
NCBI-GeneID: 938172
NCBI-ProteinID: NP_389428
Pasteur: BG11793
BSORF: BG11793
UniProt: Q45479
Position
1616744..1617208
Genome map
AA seq 154 aa AA seqDB search
MLYYMIALLIIAADQLTKWLVVKNMELGQSIPIIDQVFYITSHRNTGAAWGILAGQMWFF
YLITTAVIIGIVYYIQRYTKGQRLLGVALGLMLGGAIGNFIDRAVRQEVVDFIHVIIVNY
NYPIFNIADSSLCVGVMLLFIQMLLDSGKKKKEQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtattatatgattgcactacttattattgcagccgatcaattgacaaaatggcta
gttgttaagaacatggaacttggccaaagcattccgatcattgatcaggtattctatatc
acctcccatcgcaatacgggtgctgcatgggggatattagcgggtcaaatgtggtttttc
tacctcataacaaccgctgttattattggtattgtttattacatacagcgttatacaaag
ggacaaaggcttcttggcgttgccctcggacttatgcttggcggtgccatcggcaacttt
atcgatcgggctgtcagacaggaagttgtggattttatccatgttattattgtcaattac
aattacccgatatttaacatcgcggactcttcactatgtgtcggcgtaatgcttttattt
atacaaatgctgttggacagcgggaaaaagaaaaaggagcaatag

DBGET integrated database retrieval system