KEGG   Bacillus subtilis subsp. subtilis 168: BSU15460
Entry
BSU15460          CDS       T00010                                 

Symbol
rluD
Name
(RefSeq) RNA pseudouridine synthase YlyB
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU15460 (rluD)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BSU15460 (rluD)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU15460 (rluD)
SSDB
Motif
Pfam: PseudoU_synth_2 S4 Poly_export ThiS-like DUF4981 Ub-Mut7C S4_2
Other DBs
NCBI-GeneID: 939987
NCBI-ProteinID: NP_389429
Pasteur: BG11796
BSORF: BG11796
UniProt: Q45480 A0A6M3ZAG7
Position
1617210..1618121
AA seq 303 aa
MNQIDITASEEQKSERIDKFLASTENDWSRTQVQQWVKDGQVVVNGSAVKANYKIQPGDQ
VTVTVPEPEALDVLAEPMDLDIYYEDQDVLVVNKPRGMVVHPAPGHLTGTLVNGLMAHCT
DLSGINGVMRPGIVHRIDKDTSGLLMVAKNDMAHESLVNQLVNKTVTRKYTAVVHGLISH
DDGTIDAPIGRDKKDRQSMTVTRDGKNAVTHFHVLERFQDFTLVECQLETGRTHQIRVHM
KYIGFPLAGDPKYGPRKTIDFNGQALHAGVLGFDHPRTGEYVEFEAPLPEDMAELIENLR
KNG
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaatcaaattgatataaccgcttcagaagaacaaaaaagtgagcggattgataaattt
ttggcatcgactgagaatgattggtcaagaacccaggttcagcaatgggtaaaagacgga
caggttgtcgtgaacggaagcgcggtgaaagcgaattataaaattcagccgggtgatcag
gtgaccgtcactgtacctgaaccggaagcgctcgacgtcctggcagagcctatggatctg
gatatttattatgaggaccaggatgtgctggtcgtcaacaaacctcgcggaatggttgtt
cacccagcacccgggcatcttacgggcacacttgtaaacggtcttatggctcattgcaca
gacctttccggaataaatggtgtgatgcgcccgggtattgttcacagaatcgataaggac
acgtccggtttattaatggtggcgaaaaatgatatggcgcacgagtcactcgtaaaccaa
ttggtcaacaaaacggtcacgcggaaatatacggcggttgtccacgggcttatttctcat
gatgacggcacaattgacgcgccgatcggacgggataaaaaagaccgtcaaagcatgact
gtgacacgtgatggcaaaaacgctgtcactcattttcatgtgcttgagcgttttcaggat
tttacgttagtggagtgccagcttgaaacagggagaacccatcaaattcgtgttcatatg
aaatatatcggattcccattagcaggcgatccgaaatacggcccaagaaaaacaatcgac
tttaatggccaagcgcttcacgcgggagttttaggttttgaccatccacgaacaggagaa
tatgtcgaatttgaagcgccgcttcccgaggatatggcagaattaatcgaaaacctcaga
aaaaacggttga

DBGET integrated database retrieval system