KEGG   Bacillus subtilis subsp. subtilis 168: BSU15470
Entry
BSU15470          CDS       T00010                                 

Symbol
pyrR
Name
(RefSeq) bifunctional protein PyrR
  KO
K02825  pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15470 (pyrR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU15470 (pyrR)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     BSU15470 (pyrR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU15470 (pyrR)
SSDB
Motif
Pfam: Pribosyltran UPRTase PRTase_2 DUF1445
Other DBs
NCBI-GeneID: 938030
NCBI-ProteinID: NP_389430
Pasteur: BG10712
BSORF: BG10712
UniProt: P39765 A0A6M3ZAL2
Structure
PDB: 
4P82 1A3C 4P86 1A4X

Position
1618304..1618849
AA seq 181 aa
MNQKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGN
PVTVGEIDITLYRDDLSKKTSNDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDA
LVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQNDLVAIYEN
E
NT seq 546 nt   +upstreamnt  +downstreamnt
ttgaatcaaaaagctgtcattctcgacgaacaggcaattagacgggcgctgaccaggatt
gctcacgaaatgatcgaacgcaataaaggaatgaataactgcattcttgtcggcattaag
acaagagggatttacctggcaaaacgccttgcggaacgcattgaacagattgagggaaat
cctgttacagtcggtgaaattgatattactctttacagagatgatctttctaaaaaaaca
agcaacgatgaaccgcttgtaaaaggtgcagatattccggtagatattacagatcaaaaa
gtcattctcgttgatgatgttctgtataccggaagaacagtcagagcaggaatggatgcg
cttgttgatgtaggcagaccttcctccattcagcttgcagtgcttgtggacagaggacac
cgggagctgccgatccgagcggattatatcgggaaaaacatcccgacatcaaagtctgaa
aaggttatggtacagcttgatgaggtagaccaaaacgatctcgtcgccatttatgaaaac
gaataa

DBGET integrated database retrieval system