KEGG   Bacillus subtilis subsp. subtilis 168: BSU15480
Entry
BSU15480          CDS       T00010                                 

Symbol
pyrP
Name
(RefSeq) uracil permease
  KO
K02824  uracil permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU15480 (pyrP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU15480 (pyrP)
SSDB
Motif
Pfam: Xan_ur_permease
Other DBs
NCBI-GeneID: 936604
NCBI-ProteinID: NP_389431
Pasteur: BG10992
BSORF: BG10992
UniProt: P39766 A0A6M4JJU0
Position
1619023..1620330
AA seq 435 aa
MSKKKVNLGVRDVPTPFSWVSFSLQHLFAMFGSTILVPKLVGMSPAVALVTSGIGTLAYL
LITKGQIPAYLGSSFAFISPIILVKATGGPGAAMVGAFLAGLVYGLIALLIRQLGTGWLM
KILPPVVVGPVIIVIGLGLASTAVNMAMYADPNASELVYSLKHFSVAGVTLAITIICAIF
LRGFLSLIPVLIGIIGGYLFALTQGIVNFQPVLDAKWFAVPEFIIPFKDYSPSVTLGIAA
AMVPVAFVTMSEHIGHQMVLSKVVGQDFIKKPGLHRSIMGDSVATILASLIGGPPTTTYG
ENIGVLAITRVFSVFVIGGAAVIALCFGFIGKISALISSVPSAVMGGVSFLLFGIIASSG
LRMLIDNKIDYENNRNLIITSVILVIGVGGAFIQVSQGGFQVSGMALAAIVGVILNLILP
QAKEEQADTSEQHHI
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgagtaagaaaaaagtaaatttaggggtcagggatgtcccgacacctttctcttgggtt
tcattcagccttcagcatttgtttgccatgtttggctcaaccattttggttccgaagctc
gtcggaatgagtcctgctgtggcgttggtgacaagcggcatcggaacactggcgtacctt
cttattaccaaaggacaaattccggcgtatctcggttcatccttcgcctttatttctccg
atcattctggtaaaagcgaccggcgggccgggagcggcaatggttggagcgtttcttgca
gggctggtgtacgggctgattgccttattgattaggcagcttggaacaggatggctgatg
aagattctcccgcctgtagtcgtagggcctgttattatcgtcatcgggctgggactggca
agcactgcagtaaacatggcgatgtatgctgatccgaacgcgagtgagttggtctacagc
ttaaagcactttagtgtcgcaggagttacgctggcaattacgattatttgtgcgattttc
ttacgagggtttttaagcctgattccggttctgatcggaatcatcggcggatacctgttt
gcccttactcaagggattgtcaacttccagccggtgcttgacgcgaaatggtttgcagtg
cctgaatttatcattccgttcaaagattattcaccgtcagttacgctcggcatcgcagcc
gcaatggttcctgtcgcatttgtcacaatgtcagagcatatcggccaccaaatggtgctg
agcaaggttgtcggacaagacttcattaaaaagccaggtcttcatcgctctattatgggt
gacagtgtggcgacaatcctcgcttccctgatcggcggccctccgacaacgacttacgga
gaaaacattggcgtgctggccatcacaagagtattcagcgtctttgtcatcgggggcgcg
gcagtgattgccctttgcttcggctttatcggcaaaatttcagcgctgatcagttcagtg
ccgtcagcggtcatgggaggcgtctccttcctgctgttcggaatcattgcttcaagcggc
ctgagaatgctgattgacaacaaaattgattatgaaaacaacagaaacctcattattaca
tcagttatccttgtcatcggtgtaggaggcgcttttatccaagtgtctcagggcggattc
caagtgtcaggaatggcgcttgccgcaattgtcggtgtcatcttaaacctgattcttccg
caggcgaaggaagagcaggcagacacatctgaacaacatcatatttaa

DBGET integrated database retrieval system