KEGG   Bacillus subtilis subsp. subtilis 168: BSU15480Help
Entry
BSU15480          CDS       T00010                                 

Gene name
pyrP
Definition
(RefSeq) uracil permease
  KO
K02824  uracil permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU15480 (pyrP)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU15480 (pyrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease
Motif
Other DBs
NCBI-GeneID: 936604
NCBI-ProteinID: NP_389431
Pasteur: BG10992
BSORF: BG10992
UniProt: P39766
Position
1619023..1620330
Genome map
AA seq 435 aa AA seqDB search
MSKKKVNLGVRDVPTPFSWVSFSLQHLFAMFGSTILVPKLVGMSPAVALVTSGIGTLAYL
LITKGQIPAYLGSSFAFISPIILVKATGGPGAAMVGAFLAGLVYGLIALLIRQLGTGWLM
KILPPVVVGPVIIVIGLGLASTAVNMAMYADPNASELVYSLKHFSVAGVTLAITIICAIF
LRGFLSLIPVLIGIIGGYLFALTQGIVNFQPVLDAKWFAVPEFIIPFKDYSPSVTLGIAA
AMVPVAFVTMSEHIGHQMVLSKVVGQDFIKKPGLHRSIMGDSVATILASLIGGPPTTTYG
ENIGVLAITRVFSVFVIGGAAVIALCFGFIGKISALISSVPSAVMGGVSFLLFGIIASSG
LRMLIDNKIDYENNRNLIITSVILVIGVGGAFIQVSQGGFQVSGMALAAIVGVILNLILP
QAKEEQADTSEQHHI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaaaaagtaaatttaggggtcagggatgtcccgacacctttctcttgggtt
tcattcagccttcagcatttgtttgccatgtttggctcaaccattttggttccgaagctc
gtcggaatgagtcctgctgtggcgttggtgacaagcggcatcggaacactggcgtacctt
cttattaccaaaggacaaattccggcgtatctcggttcatccttcgcctttatttctccg
atcattctggtaaaagcgaccggcgggccgggagcggcaatggttggagcgtttcttgca
gggctggtgtacgggctgattgccttattgattaggcagcttggaacaggatggctgatg
aagattctcccgcctgtagtcgtagggcctgttattatcgtcatcgggctgggactggca
agcactgcagtaaacatggcgatgtatgctgatccgaacgcgagtgagttggtctacagc
ttaaagcactttagtgtcgcaggagttacgctggcaattacgattatttgtgcgattttc
ttacgagggtttttaagcctgattccggttctgatcggaatcatcggcggatacctgttt
gcccttactcaagggattgtcaacttccagccggtgcttgacgcgaaatggtttgcagtg
cctgaatttatcattccgttcaaagattattcaccgtcagttacgctcggcatcgcagcc
gcaatggttcctgtcgcatttgtcacaatgtcagagcatatcggccaccaaatggtgctg
agcaaggttgtcggacaagacttcattaaaaagccaggtcttcatcgctctattatgggt
gacagtgtggcgacaatcctcgcttccctgatcggcggccctccgacaacgacttacgga
gaaaacattggcgtgctggccatcacaagagtattcagcgtctttgtcatcgggggcgcg
gcagtgattgccctttgcttcggctttatcggcaaaatttcagcgctgatcagttcagtg
ccgtcagcggtcatgggaggcgtctccttcctgctgttcggaatcattgcttcaagcggc
ctgagaatgctgattgacaacaaaattgattatgaaaacaacagaaacctcattattaca
tcagttatccttgtcatcggtgtaggaggcgcttttatccaagtgtctcagggcggattc
caagtgtcaggaatggcgcttgccgcaattgtcggtgtcatcttaaacctgattcttccg
caggcgaaggaagagcaggcagacacatctgaacaacatcatatttaa

DBGET integrated database retrieval system