KEGG   Bacillus subtilis subsp. subtilis 168: BSU15500
Entry
BSU15500          CDS       T00010                                 

Symbol
pyrC
Name
(RefSeq) dihydroorotase
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15500 (pyrC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     BSU15500 (pyrC)
SSDB
Motif
Pfam: Amidohydro_1 DHOase Amidohydro_3 DUF6282
Other DBs
NCBI-GeneID: 937095
NCBI-ProteinID: NP_389433
Pasteur: BG10714
BSORF: BG10714
UniProt: P25995 A0A6M4JMV2
Position
1621374..1622660
AA seq 428 aa
MSYLIKNGWILNENGEKTQADIRVTGETITAIGKLDATDNETVIDAKGLLVSPGFVDLHV
HFREPGGEKKETIETGAKAAARGGYTTVAAMPNTRPVPDTKEQMEWVQNRIKETSCVRVL
PYASITIRQIGDEMTNFEALKEAGAFAFTDDGVGIQTAGMMYEAMKRAAAIDKAIVAHCE
DNSLIYGGSVHEGTFSKANGLNGIPSVCESVHIARDVLLAEAANCHYHVCHISTKESVRV
VRDAKKAGIRVTAEVSPHHLLLCDEDIPGLDTNYKMNPPLRSPEDRAALIEGLLDGTIDF
IATDHAPHTEEEKNTEMKLAPFGIVGLETAFPLLYTHFVKNGSWSLKQLIDYMTIKPCEA
FGLPYGTLQTGQAADITLIDLEKEAVIDKETFLSKGKNTPFNGISCTGWPVATIAAGKLA
YEEGRLVK
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgtcatatctcattaaaaacggctggatactaaacgaaaatggtgaaaaaacacaagcg
gatatccgagtgactggagaaaccatcaccgcaatcggcaagcttgatgcaacggataat
gaaacggtaattgatgcaaaaggtttgctcgtttcacctgggtttgttgatctccacgtg
catttcagagagccgggcggagagaaaaaagaaactattgaaaccggggcaaaagcagcg
gcgcgcggcggctatactacagtagcagcaatgccgaatacgcggccggttcctgataca
aaggagcagatggaatgggtgcaaaacagaattaaagaaacatcatgcgtaagagttctt
ccatatgcatccattacgatcagacaaatcggcgatgaaatgacaaactttgaagcgtta
aaagaagccggggcatttgcttttacagatgacggcgttggtatacagacagcaggaatg
atgtatgaagcgatgaaacgggcagccgcaattgacaaagcgattgttgcacattgcgag
gacaactccttaatttacggagggagcgtacatgaggggacattctccaaagcgaacggg
ctaaacggcattccttctgtgtgtgaatcggttcatattgctcgcgatgtgctgctggct
gaggcggcaaactgccattatcatgtatgccatatcagcacaaaagaatctgtcagagtt
gtacgcgatgcgaaaaaagcgggaatcagagtgacagcagaagtatcgccgcatcatttg
ctgctttgtgatgaggacatcccggggctggacacaaactataaaatgaatcctccgctc
cgcagcccagaagacagagctgctttaattgaaggtcttttagacggaacaattgatttt
atcgcaacagaccatgcaccgcatacggaagaagagaagaacacagaaatgaagctggcg
ccattcggaattgtcggcttagaaacagcattcccgcttctttacacacactttgtcaaa
aatggcagctggtcactgaagcagctgattgactacatgacaatcaagccatgcgaagcg
ttcggtctcccatatggaacattacaaacggggcaagctgcggacattacgttaatcgat
ttagaaaaagaagcagttatagacaaagagacatttttatcaaaaggaaaaaatacacca
ttcaacggcatcagttgcaccggctggccggtcgctacaattgcggcagggaagcttgct
tatgaagaggggagacttgtcaaatga

DBGET integrated database retrieval system