KEGG   Bacillus subtilis subsp. subtilis 168: BSU15510
Entry
BSU15510          CDS       T00010                                 

Symbol
pyrAA
Name
(RefSeq) carbamoyl-phosphate synthase pyrimidine-specific small chain
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15510 (pyrAA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU15510 (pyrAA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     BSU15510 (pyrAA)
SSDB
Motif
Pfam: CPSase_sm_chain GATase Peptidase_C26 DUF807
Other DBs
NCBI-GeneID: 937368
NCBI-ProteinID: NP_389434
Pasteur: BG10715
BSORF: BG10715
UniProt: P25993 A0A6M4JLN8
Position
1622657..1623751
AA seq 364 aa
MKRRLVLENGAVFEGEAFGSLEHNMGEVVFNTGMTGYQEILSDPSYCGQIVTLTYPLIGN
YGINRDDFESITPFVKGLIIKELCELPSNWRSAYTLDEYLKMKNIPGLQGIDTRKLTRMI
RTAGALKGTFASSDEDIEAVLKRLNETELPRNQVSQVSAKTAYPSPGRGKRIVLVDFGMK
HGILRELNKRKCDVIVVPYNITAEEVLQLKPDGIMLSNGPGDPKDVPEAIEMIKGVLGKV
PLFGICLGHQLFALACGANTEKMKFGHRGSNHPVKELATGKVALTSQNHGYTVSSISKTE
LEVTHIAINDDTIEGLKHKTLPAFTVQYHPEASPGPEDANHLFDRFIEMIETTEKEGEAV
CQNA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgaagagacgattagtactggaaaacggagcggtattcgagggagaagctttcggaagc
ttagaacacaacatgggagaagtcgtttttaatactgggatgacaggctatcaggaaatt
ttatctgatccttcttactgcggacagatcgtaacattaacatacccgcttatcggaaat
tacggcattaaccgtgatgattttgaatccattaccccttttgtcaaagggctgatcatc
aaagaattatgtgagctgccttccaactggcgttcagcatacaccttagacgagtattta
aaaatgaaaaacattcccggactccagggaattgatacaaggaagctgacaagaatgatc
cgcacggcaggcgcgctaaaaggaacattcgcttcatctgatgaagatatcgaagcagtg
ctgaaaagactgaacgaaacggaattgccaagaaatcaagtatcccaagtatcagcaaaa
acagcatatccgagcccgggaagaggcaaacgcattgtcttggttgacttcggcatgaaa
cacgggattctaagagagctgaacaaacggaaatgtgacgtcatcgttgtgccttacaac
attacagcggaagaggtgcttcagctgaaaccggacggtatcatgctttctaacggacct
ggagacccgaaggatgtgcctgaagcgattgaaatgattaaaggtgttcttggaaaagtg
ccattattcggaatatgtctcggccaccaattattcgcgctggcgtgcggggcgaatact
gaaaaaatgaaattcggccacaggggctcaaaccacccggtaaaagagctggctacagga
aaagttgccttaacatctcaaaaccatggatatacagtttcgtctatcagtaaaacagaa
ctggaagtgacgcatatcgcaattaacgacgatacgattgaagggctgaagcataaaaca
ttgccggcatttacggttcaatatcatcccgaagcctcacctggtcctgaggatgccaac
catctatttgacagattcatcgaaatgatcgaaacaacagagaaagaaggggaagcggta
tgccaaaacgcgtag

DBGET integrated database retrieval system