KEGG   Bacillus subtilis subsp. subtilis 168: BSU15520Help
Entry
BSU15520          CDS       T00010                                 

Gene name
carB
Definition
(RefSeq) carbamoyl-phosphate synthase pyrimidine-specific large chain
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15520 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU15520 (carB)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     BSU15520 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 ATPgrasp_Ter Dala_Dala_lig_C MGS ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_4 RimK ATP-grasp_5 Epimerase
Motif
Other DBs
NCBI-GeneID: 936608
NCBI-ProteinID: NP_389435
Pasteur: BG10716
BSORF: BG10716
UniProt: P25994
Position
1623736..1626951
Genome map
AA seq 1071 aa AA seqDB search
MPKRVDINKILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYEVILVNSNPATIMTDTEM
ADRVYIEPLTPEFLTRIIRKERPDAILPTLGGQTGLNLAVELSERGVLAECGVEVLGTKL
SAIQQAEDRDLFRTLMNELNEPVPESEIIHSLEEAEKFVSQIGFPVIVRPAYTLGGTGGG
ICSNETELKEIVENGLKLSPVHQCLLEKSIAGYKEIEYEVMRDSQDHAIVVCNMENIDPV
GIHTGDSIVVAPSQTLSDREYQLLRNVSLKLIRALGIEGGCNVQLALDPDSFQYYIIEVN
PRVSRSSALASKATGYPIAKLAAKIAVGLSLDEMMNPVTGKTYAAFEPALDYVVSKIPRW
PFDKFESANRKLGTQMKATGEVMAIGRTLEESLLKAVRSLEADVYHLELKDAADISDELL
EKRIKKAGDERLFYLAEAYRRGYTVEDLHEFSAIDVFFLHKLFGIVQFEKELKANAGDTD
VLRRAKELGFSDQYISREWKMKESELYSLRKQAGIAPVFKMVDTCAAEFESETPYFYSTY
EEENESVVTDKKSVMVLGSGPIRIGQGVEFDYATVHSVWAIKQAGYEAIIVNNNPETVST
DFSISDKLYFEPLTIEDVMHIIDLEQPMGVVVQFGGQTAINLADELSARGVKILGTSLED
LDRAEDRDKFEQALGELGVPQPLGKTATSVNQAVSIASDIGYPVLVRPSYVLGGRAMEIV
YHEEELLHYMKNAVKINPQHPVLIDRYLTGKEIEVDAVSDGETVVIPGIMEHIERAGVHS
GDSIAVYPPQSLTEDIKKKIEQYTIALAKGLNIVGLLNIQFVLSQGEVYVLEVNPRSSRT
VPFLSKITGIPMANLATKIILGQKLAAFGYTEGLQPEQQGVFVKAPVFSFAKLRRVDITL
GPEMKSTGEVMGKDSTLEKALYKALIASGIQIPNYGSVLLTVADKDKEEGLAIAKRFHAI
GYNILATEGTAGYLKEASIPAKVVGKIGQDGPNLLDVIRNGEAQFVINTLTKGKQPARDG
FRIRRESVENGVACLTSLDTAEAILRVLESMTFRADQMPAVNTNQEAAVTI
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacgcgtagacattaacaaaattttagtaatcggatctggaccgatcatcatc
ggccaagcagcagaatttgactatgcgggaacacaagcctgtcttgctttgaaagaagaa
ggctatgaagtcatccttgtcaactcaaaccctgcaacgatcatgacagatacagaaatg
gctgaccgggtttacatcgaaccgctcacacctgaattcctgacacgaatcatcagaaaa
gagcgcccggatgccattcttcctacactcggaggccaaaccggtttgaatcttgcggtt
gagctttctgaaagaggcgttttggcagaatgcggcgtcgaagtgcttggcacgaaactg
tctgcgattcagcaagctgaagaccgtgacttgttcagaacattaatgaatgaactgaat
gaaccggtgcctgaaagtgagattatccactcccttgaagaagcagaaaaattcgtcagt
caaattggattccctgtcattgtccgcccggcatatacattaggcggaacaggcggaggc
atctgctcgaatgaaacagagctaaaagaaatcgttgagaacggcttgaaattaagcccg
gtacaccaatgtctgcttgaaaaaagcatcgccggctataaagaaatcgagtatgaagtc
atgagagacagccaggatcacgccattgtcgtttgtaacatggaaaacattgatccagtt
ggaatccatactggagacagtattgttgtcgcgccgagccaaacgctcagcgatcgcgaa
tatcagctcttgcggaatgtatcgttaaaactgattcgcgcgcttgggatcgaaggcgga
tgtaatgtccagctcgccttagatccagacagcttccaatattacattattgaagtaaat
ccgcgtgtcagccgttcatctgcccttgcatcaaaagcaacggggtacccgattgcaaag
ctcgctgctaaaattgcagtcggactttcattagatgaaatgatgaacccggtgacagga
aaaacatatgcagcatttgaacctgctcttgactatgtcgtatccaaaattccgcgctgg
ccgtttgataagtttgaatcagcaaacagaaagcttggcacgcaaatgaaagcgacaggt
gaggtcatggcaatcggccgcacgcttgaagagtcattgctgaaggcagtgcgatcactg
gaagcggatgtgtatcatcttgaattgaaggacgccgctgacatttcagatgagcttctt
gaaaagcgaattaaaaaggccggtgatgaacgcttattctacttagctgaagcgtacaga
agaggctacacggtagaagacctccatgaattttccgctatcgatgtcttcttcttgcat
aagctgttcggaatcgtacagtttgaaaaagaattgaaggccaatgcgggcgatacagat
gtgctgagacgggcaaaagaactcggcttctctgatcagtacatcagccgtgaatggaaa
atgaaagaatctgagctttacagcttgagaaaacaagcggggattgcgccggtattcaaa
atggtagatacatgcgcggcggaatttgagtcagaaacgccatacttctatagcacatat
gaagaagaaaatgaatctgtcgttacagataagaaaagtgtgatggtgcttggttcgggt
ccgattcgaatcggtcagggtgtcgagttcgactatgcgacggttcactctgtatgggca
attaaacaagcaggctatgaagccattattgtcaacaacaacccggaaaccgtttcaaca
gacttcagcatctcagacaagctgtattttgaaccgcttacgattgaagatgtcatgcac
atcattgacctcgaacagccaatgggcgttgtcgtacaatttggcggacaaactgcgatt
aaccttgctgacgagctttctgcacgcggagtgaaaatccttggaacttcattagaagat
ttagaccgtgccgaagaccgggataaatttgaacaagcgcttggagaacttggtgttcct
cagccgcttggcaaaacagcgacatcagttaatcaggcggtaagcatcgcaagtgatatc
ggttatccggtactggtacgcccttcctatgtacttggcggccgggcgatggagattgtt
taccatgaagaggaactgcttcattacatgaaaaatgcagtcaaaatcaatccacagcac
cctgtattaattgatagatacttgaccggaaaagaaattgaagtcgatgcagtatccgac
ggtgaaacagtcgtcattccgggaattatggagcacattgaacgtgcgggcgttcactcc
ggagactcaatcgctgtttatccgcctcagtctctcacagaggacattaagaaaaaaatt
gaacaatacacgatcgcattggctaaagggctgaatattgtcggtttgctcaatattcaa
ttcgtcttgtcgcaaggcgaggtgtacgtgctagaagtgaatccgagatcaagcagaacc
gtaccgtttttaagcaaaattacgggtatcccaatggcgaatctcgcaacaaaaatcatt
cttggtcaaaagctggctgcgtttggctatacagagggccttcagcctgaacagcaaggt
gtatttgtaaaagcgccggtcttctcctttgccaagctgagaagagtggatattacgtta
gggcctgaaatgaaatcaacaggtgaagtcatggggaaagattcgacacttgaaaaggcg
ctctacaaagccttgatcgcttcaggtattcaaatcccgaactacggttccgtgctttta
acagtagctgataaggacaaagaagaagggcttgccattgctaagcggttccacgcgatc
ggctacaacattttagcgacggaaggaacggcaggctacctgaaagaagcttccattcca
gcgaaggtcgtcggaaaaatcggtcaggatggcccgaacttgcttgatgtcatcagaaac
ggagaagcgcagtttgtcatcaatacgctgacaaaaggaaagcagccggcaagagacggt
tttagaatcagacgtgaatcagtagaaaatggtgttgcctgcctaacatctttagatacg
gcagaggcgatattgcgagtgctggaaagcatgacattccgtgctgatcaaatgccggca
gtcaacacaaatcaggaggcggcagtcactatatga

DBGET integrated database retrieval system