KEGG   Bacillus subtilis subsp. subtilis 168: BSU15530
Entry
BSU15530          CDS       T00010                                 

Symbol
pyrK
Name
(RefSeq) dihydroorotate dehydrogenase B
  KO
K02823  dihydroorotate dehydrogenase electron transfer subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15530 (pyrK)
SSDB
Motif
Pfam: DHODB_Fe-S_bind NAD_binding_1 FAD_binding_6
Other DBs
NCBI-GeneID: 936854
NCBI-ProteinID: NP_389436
Pasteur: BG10717
BSORF: BG10717
UniProt: P25983 A0A6M3ZAT8
Position
1626948..1627718
AA seq 256 aa
MKKAYLTVCSNQQIADRVFQMVLKGELVQGFTTPGQFLHLKVSEAVTPLLRRPISIADVN
FEKNEVTIIYRVDGEGTRLLSLKQQGELVDVLGPLGNGFPVNEVQPGKTALLVGGGVGVP
PLQELSKRLIEKGVNVIHVLGFQSAKDVFYEEECRQYGDTYVATADGSYGETGFVTDVIK
RKKLEFDILLSCGPTPMLKALKQEYAHKEVYLSMEERMGCGIGACFACVCHTNESETSYV
KVCLDGPVFKAQEVAL
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaaaaaagcgtatttgacagtatgttctaaccagcaaattgcagaccgggtgtttcaa
atggttctgaaaggggagcttgtccaagggtttacaacccctggacagttccttcatctt
aaagtgagcgaagcggttacgcctcttttgagaaggccgatcagcatcgcagacgtcaac
tttgaaaaaaatgaagtcaccatcatttatcgggtagatggggaagggacaagactcttg
tcactgaagcagcagggagaacttgtggatgtcctcgggcctttgggaaatggctttcct
gttaatgaagttcaacccggaaagacggctttgctggtaggaggcggagtaggtgtgccg
cctctccaagagctgtcgaaacgcttgattgaaaaaggggtaaatgtcatccacgtttta
ggattccaatcggcaaaggatgttttttacgaggaagaatgccggcagtacggagacacg
tatgtggcaacagctgacggaagctacggggaaaccggatttgtcacagatgtgattaaa
cggaaaaagctagagtttgatatcctcctcagctgcgggccgacaccgatgctcaaggcg
ttaaaacaggaatatgcccataaagaagtatatctgtccatggaggaacgaatgggctgc
ggaatcggcgcatgcttcgcgtgtgtgtgccatacaaacgaaagtgagacatcctatgta
aaagtatgtctcgacgggcctgtatttaaagctcaggaggtggcgctgtaa

DBGET integrated database retrieval system