KEGG   Bacillus subtilis subsp. subtilis 168: BSU15540
Entry
BSU15540          CDS       T00010                                 

Gene name
pyrD
Definition
(RefSeq) dihydroorotate dehydrogenase B
  KO
K17828  dihydroorotate dehydrogenase (NAD+) catalytic subunit [EC:1.3.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15540 (pyrD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.14  dihydroorotate dehydrogenase (NAD+)
     BSU15540 (pyrD)
Motif
Pfam: DHO_dh Dus His_biosynth NMO DUF561 IMPDH G3P_antiterm FMN_dh TMP-TENI Glu_synthase
Other DBs
NCBI-GeneID: 938008
NCBI-ProteinID: NP_389437
Pasteur: BG10718
BSORF: BG10718
UniProt: P25996 A0A6M3ZAL4
Position
1627718..1628653
AA seq 311 aa
MLEVKLPGLDLKNPIIPASGCFGFGKEFSRFYDLSCLGAIMIKATTKEPRFGNPTPRVAE
TGAGMLNAIGLQNPGLDSVLHHELPWLEQFDTPIIANVAGSQVDDYVEVAEHISKAPNVH
ALELNISCPNVKTGGIAFGTNPEMAADLTKAVKEVSDVPVYVKLSPNVANITEIALAIEE
AGADGLTMINTLIGMRLDLKTGKPILANKTGGLSGPAVKPVAIRMVYEVSQMVNIPIIGM
GGVQTAEDALEFLLAGASAVAVGTANFVNPFACPEIIEQLPSVLLQYGYQSIEECIGRSW
NHEKQPAHHRA
NT seq 936 nt   +upstreamnt  +downstreamnt
atgctagaggtgaaattgccgggacttgatttgaaaaacccaatcattcctgcatcaggc
tgcttcggttttggaaaagaattttcacgtttttatgatttgtcttgtcttggagctatc
atgattaaggctacgacaaaggagccgcgctttgggaatccgacgccgcgggtagctgag
actggtgctggaatgctcaatgcgatcggtctccaaaatccggggctggatagtgtgttg
catcatgagctgccgtggcttgagcagtttgatacaccgatcattgccaatgtcgcaggt
tctcaagtcgatgattatgttgaagtcgcagaacatatcagcaaagcgcctaatgttcat
gctcttgaattgaatatttcctgcccgaatgtgaaaacaggcggaatcgcttttggcacg
aatcctgaaatggctgccgatttgacaaaagcggtgaaagaggtttcggatgtacccgtt
tatgtgaagctatccccgaacgtggctaatatcacagaaattgcattagcgatcgaggaa
gcgggagcggacggtcttacgatgatcaacacactaatcggcatgagactcgatttaaaa
accggcaaaccgatattagcgaataaaacagggggactttcgggccctgctgtgaagccg
gttgccattcgcatggtgtatgaagtcagccagatggtcaacatcccgattatcggaatg
ggaggcgtgcaaacggctgaagatgccctggaatttcttctcgcgggagcaagcgcagtc
gctgtcggaacagcaaactttgtgaatccttttgcatgtccagagattattgaacagctc
ccatctgttttgctccaatacggctatcaatcaattgaagaatgcatcggaaggagctgg
aatcatgaaaaacaacctgcccatcatcgcgcttga

DBGET integrated database retrieval system