KEGG   Bacillus subtilis subsp. subtilis 168: BSU15550
Entry
BSU15550          CDS       T00010                                 

Gene name
pyrF
Definition
(RefSeq) orotidine 5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15550 (pyrF)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     BSU15550 (pyrF)
Motif
Pfam: OMPdecase
Other DBs
NCBI-GeneID: 935960
NCBI-ProteinID: NP_389438
Pasteur: BG10719
BSORF: BG10719
UniProt: P25971 A0A6M4JIJ4
Structure
PDB: 
1DBT

Position
1628622..1629341
AA seq 239 aa
MKNNLPIIALDFASAEETLAFLAPFQQEPLFVKVGMELFYQEGPSIVKQLKERNCELFLD
LKLHDIPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEGTPAGKKRPSLIAVT
QLTSTSEQIMKDELLIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAIYQAVSPSFLTV
TPGIRMSEDAANDQVRVATPAIAREKGSSAIVVGRSITKAEDPVKAYKAVRLEWEGIKS
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaaaaacaacctgcccatcatcgcgcttgattttgcgtcagctgaagaaacacttgcg
ttcttagcgccttttcagcaagaaccgttatttgtaaaggttgggatggagcttttttat
caagaagggccatctatcgtgaaacaactaaaagaaagaaactgcgagctatttttagat
ctaaagcttcatgacatcccgactactgtaaacaaagcgatgaagcgccttgccagtctt
ggagtagacctcgtcaatgttcatgctgccgggggcaaaaaaatgatgcaggcagctctc
gaaggcttagaagaaggtacgccggctggaaaaaaacgtccgtcacttatcgcggtaacc
cagctgacaagcacatctgaacaaatcatgaaagatgaactgctgatcgaaaagtctctg
attgatacggttgtgcactacagcaaacaggcggaagaaagcggactggatggagtggtc
tgctctgttcatgaagcaaaagccatttaccaagcggtgtcgccttcatttctgactgtc
actccggggatcagaatgtcagaggacgctgcgaatgaccaagttcgcgtagcgacgcct
gccattgcaagagagaaaggttcatcagcgattgtagtaggacgctcgattacaaaagcg
gaagacccggtaaaagcctataaggctgtcagacttgaatgggagggaatcaaatcttga

DBGET integrated database retrieval system