KEGG   Bacillus subtilis subsp. subtilis 168: BSU15560
Entry
BSU15560          CDS       T00010                                 

Symbol
pyrE
Name
(RefSeq) orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU15560 (pyrE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     BSU15560 (pyrE)
SSDB
Motif
Pfam: Pribosyltran PsbJ
Other DBs
NCBI-GeneID: 936714
NCBI-ProteinID: NP_389439
Pasteur: BG10720
BSORF: BG10720
UniProt: P25972 A0A6M4JIG9
Position
1629320..1629970
AA seq 216 aa
MGGNQILKQIIAKHLLDIQAVFLRPNEPFTWASGILSPIYCDNRLTLSFPEVRNDVASGI
SKLVKEHFPEAEMIAGTATAGIPHAALAADHLNLPMCYVRSKPKAHGKGNQIEGAVQEGQ
KTVVIEDLISTGGSVLEACAALQAAGCEVLGVVSIFTYGLPKAEEAFAKAELPYYSLTDY
DTLTEVALENGNIHSDDLKKLQTWKRNPESKDWFKK
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagggaatcaaatcttgaaacaaatcatcgcaaaacatctattagacatccaagct
gtatttttacgcccgaacgagccgttcacatgggcaagcggcattttatcaccgatctac
tgtgacaaccgccttacgctatctttcccagaggtcagaaacgatgttgcttcaggtatc
agcaagcttgttaaagagcattttcctgaagctgaaatgattgcgggaacagcaactgcc
ggtattcctcatgctgctcttgcggcggaccatttgaatcttccgatgtgttatgtgagg
agcaagccgaaggcgcacggaaaaggcaatcagattgagggagctgtgcaagaagggcaa
aaaacagtcgtcattgaagacttaatttccacaggaggcagcgtgcttgaagcttgtgca
gctttacaagcggccggctgtgaagtgcttggtgtcgtctcaatctttacgtacggactt
cctaaagcggaggaagccttcgcaaaggcagaactgccatactactcattaaccgattat
gatacgctcacagaggtcgcgcttgaaaacggaaatattcattcagatgatctaaaaaag
ctgcaaacatggaaacgaaatcccgagtcaaaagattggtttaaaaaataa

DBGET integrated database retrieval system