KEGG   Bacillus subtilis subsp. subtilis 168: BSU15570
Entry
BSU15570          CDS       T00010                                 

Symbol
cysH
Name
(RefSeq) phosphoadenosine phosphosulfate reductase
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU15570 (cysH)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     BSU15570 (cysH)
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     BSU15570 (cysH)
SSDB
Motif
Pfam: PAPS_reduct
Other DBs
NCBI-GeneID: 938645
NCBI-ProteinID: NP_389440
Pasteur: BG11930
BSORF: BG11930
UniProt: P94498 A0A6M4JHZ8
Position
1630382..1631083
AA seq 233 aa
MLTYDNWEEPTITFPEDDPYKGALSVLKWAYGHYGDQLVYACSFGIEGIVLIDLIYKVKK
DAEIVFLDTGLHFKETYETIERVKERYPGLNIILKKPDLTLEEQAEEHGDKLWEREPNQC
CYLRKVVPLREALSGHPAWLSGLRRDQGPSRANTNFLNKDEKFKSVKVCPLIHWTWKDIW
RYTSRNELDYNPLHDQGYPSIGCAPCTSPAFTAEDLRSGRWNGMAKTECGLHE
NT seq 702 nt   +upstreamnt  +downstreamnt
atgttaacgtatgataattgggaagaaccaacgattacatttccggaagacgatccttat
aaaggagcgctgtcagttttaaaatgggcatacggccattacggcgatcagcttgtttat
gcctgcagtttcggaattgagggaatcgttctgattgacttaatttataaagtgaaaaaa
gacgcagagattgtgtttcttgatacaggacttcattttaaagaaacctatgaaacaatt
gaacgagtgaaagagcgttatccgggtcttaatatcatcctgaaaaaaccagatctcacc
cttgaggaacaagccgaagaacatggtgacaaactatgggaaagagagccgaatcagtgc
tgctatcttagaaaggtcgttcctttaagagaggcgctttcaggacatccagcctggctt
tccggcctgcgccgtgatcaagggccaagccgtgccaatacgaatttcttaaacaaagat
gaaaaattcaagtcagtaaaagtttgcccgcttatccattggacttggaaagacatttgg
agatatacatcccggaatgaactggactacaatccgcttcatgaccaaggctatccaagt
attggctgtgcgccttgcacttctcccgcttttacagcagaagatttgcgctcaggcaga
tggaatggtatggcgaaaacagaatgcggactgcatgaataa

DBGET integrated database retrieval system