KEGG   Bacillus subtilis subsp. subtilis 168: BSU15580Help
Entry
BSU15580          CDS       T00010                                 

Gene name
cysP
Definition
(RefSeq) sulfate permease CysP
  KO
K16331  sulfate permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU15580 (cysP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU15580 (cysP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 935990
NCBI-ProteinID: NP_389441
Pasteur: BG13377
BSORF: BG13377
UniProt: O34734
Position
1631095..1632159
Genome map
AA seq 354 aa AA seqDB search
MELAAILFSLFFAMNIGASGAAASMGVAYGSGAIKKKTYALILCAVGVFAGAVIGGGEVV
KTISSGIIPEQTITLTIVCIIIGAAALSLFTANLLGIPLSTSEVTVGAVVGVGVAYKVLF
VNNLLIIVSFWVFVPLFAFGFTYFVSKLFRYFKIEVKSSKKQKILGIVLLVAGFFEAFSA
GMNNVANAVGPLVAAGVLDVGKGTLYGGAFVALGALLLGRRVLETNGKKITRFSKGEGIL
LSGTGAGLVIISSVFGMPVPLAQVTSSSIIGIGMAKNGPNVFHKQVVQTMLKVWIVSPFL
SLSISYLLVSLFLKADYYSIFIMVSVLLAAGGAISLTKAIRKERRSVHEQGGGI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaattagccgctattttatttagcttgtttttcgcgatgaatattggtgcaagcggc
gctgcagcttcgatgggggttgcttacggctccggagccatcaaaaagaaaacttacgct
ttgatcctatgcgcagtcggtgtctttgccggggcggtcattggcggaggcgaggttgta
aaaacaatcagctccggcattattcctgagcagacgattacactgacgattgtttgcatc
attattggagctgctgccctgtcgctctttactgctaatctgctcggcattcctttgtcg
acaagtgaagtaacagtcggcgcggttgtcggcgtgggagtggcttataaagtattgttt
gtgaacaatcttctgatcattgtgtcattttgggtttttgtcccgctgttcgctttcggc
ttcacctatttcgtatctaagctgtttcgttattttaagattgaagtaaaatcttctaaa
aagcaaaaaatcctcggcattgttttgttagttgccggatttttcgaagcattctctgcc
ggcatgaataacgtggcgaatgctgttggcccgttagtagctgccggtgtgcttgatgtc
ggaaaaggaaccttgtatggaggagcttttgttgctcttggcgcactgttattaggccgg
cgagtgctagaaacaaacgggaagaaaattacgaggttctccaaaggggaaggcattctc
ttatccggtacaggagcgggactggtgatcatcagttctgtatttgggatgccggtgccc
ttggcgcaagtcacgtcatcgtctattatcggaataggcatggcgaaaaacggtccgaac
gtgttccataaacaagttgttcaaacgatgctgaaggtatggatcgtatcgccgttttta
tctttatcgatttcttatctgcttgtatccttgtttttaaaagcagattattattcgatc
tttatcatggtaagtgtgcttttagcggcgggcggtgccatcagcctgacaaaggccatt
cgtaaagagagacgctcagtccacgaacaaggcgggggaatctga

DBGET integrated database retrieval system