KEGG   Bacillus subtilis subsp. subtilis 168: BSU15610
Entry
BSU15610          CDS       T00010                                 

Symbol
sumT
Name
(RefSeq) uroporphyrinogen-iii C-methyltransferase
  KO
K02303  uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU15610 (sumT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BSU15610 (sumT)
SSDB
Motif
Pfam: TP_methylase
Other DBs
NCBI-GeneID: 936712
NCBI-ProteinID: NP_389444
Pasteur: BG13380
BSORF: BG13380
UniProt: O34744 A0A6M4JLP6
Position
1634061..1634834
AA seq 257 aa
MGKVYIVGAGPGDPDLLTIKALKAIEKADVILYDRLVNKEILQYAKEQADLIYCGKLPDF
HTMKQETINRFLVKYAQKGKMVVRLKGGDPFVFGRGGEEAECLSENGIPFEIIPGITSGI
AAAAYAGIPVTHRDAGSNVAFVTGHYKKEEDFEEKWKALATGIDTLVIYMGIKNVQQIER
KLLENGRDGSTPAAFIHWGTTDKQKSVFCTVDTLSETVIKENITNPSLIVIGNVVNYHYK
LEWFESELKKQDLSEAL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggggaaagtatatattgtaggagcgggtcccggtgaccctgatctgctgacaattaaa
gcgctgaaagccattgaaaaagctgatgtcatcttatatgacagattagtaaataaagag
attttacaatatgccaaagagcaagcagacctgatctactgcgggaagcttccggatttt
catacgatgaagcaggaaaccatcaatcgatttcttgtgaagtatgcgcaaaaagggaaa
atggttgtcagactgaaaggcggagacccttttgtgttcgggagaggaggggaagaagcg
gaatgcctctctgaaaatggaattccgtttgaaatcattcccggcattacgtctggaatc
gcggcagccgcttatgccgggattcctgttacccatcgggatgcgggctctaacgtcgct
tttgtaacgggtcactataaaaaagaagaagattttgaggaaaagtggaaagcgctggct
acaggaattgatacacttgtcatctatatgggtatcaaaaacgtgcagcagattgaaaga
aaactccttgaaaatggccgggacggttctacgccagcagcctttattcattgggggaca
acggacaagcaaaaatctgttttttgtacagttgacaccctttcagaaacggtgataaaa
gaaaacattacaaatccgagtttaattgtcattggaaatgttgtaaattatcactataag
ctggaatggtttgaatctgaactaaaaaaacaagatttaagcgaggcgttgtaa

DBGET integrated database retrieval system