KEGG   Bacillus subtilis subsp. subtilis 168: BSU15620
Entry
BSU15620          CDS       T00010                                 

Gene name
sirB
Definition
(RefSeq) sirohydrochlorin ferrochelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU15620 (sirB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BSU15620 (sirB)
Motif
Pfam: CbiX CbiK WAK_assoc
Other DBs
NCBI-GeneID: 936218
NCBI-ProteinID: NP_389445
Pasteur: BG13381
BSORF: BG13381
UniProt: O34632 A0A6M3ZB06
Structure
PDB: 
5ZT8 5ZT9 5ZT7 5ZTA

Position
1634837..1635622
AA seq 261 aa
MKQAILYVGHGSRVKKAQQEAAAFLEGCKAHISVPVQEISFLELQEPTIETGFEACVKQG
ATHIAVVPLLLLTAAHAKHDIPEEIVRVASRYPSVRISYGKPIGIDEEVVKAVYHRMKDI
GVPYENARVVLIGRGSSDPDVKRDVTGIANLLQEMVPVKEVIPCFLTACGPNYKEVFSEL
EKDDGITTFIVPYLLFTGMLMNEIEREVQKLKAHNPNVYLSSYIGFHPHVKNAFLNRVRE
TAANSEGQFDFDGGSYASAAH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaaacaagcaattttatatgtcggccacggcagccgggtcaaaaaagcgcagcaagaa
gccgcagcctttttggaaggatgcaaggcccacatctctgtgccagtacaagaaatcagc
tttttagagcttcaggagccgacaattgagacaggatttgaagcatgtgtgaagcaaggt
gccactcatatcgcagtggtgcctctgcttcttttaacagctgcgcatgcaaaacatgat
attccggaagaaattgtccgtgttgcatctcgatatccatcagtccgtatttcatacgga
aagccgatcgggattgacgaagaagtagtcaaggctgtatatcaccgaatgaaagacata
ggtgttccgtatgaaaatgccagagtggtgctcatcggaaggggaagttcagatccagac
gtcaaaagagacgtaaccggaattgctaatcttcttcaggaaatggttccagtgaaggaa
gtcattccgtgctttttgacagcatgcggccctaattacaaagaggttttttcagaactt
gaaaaagatgacggcataacaacctttatcgttccatatttgctttttacgggtatgctg
atgaatgaaatcgaacgagaggttcagaaattaaaagcccataatccgaacgtctacctc
tcttcctatatcggttttcatcctcatgtgaaaaacgcatttttgaaccgtgtgagagaa
actgcggcaaattctgagggacaatttgattttgatggaggttcatatgcttccgctgca
cattag

DBGET integrated database retrieval system