KEGG   Bacillus subtilis subsp. subtilis 168: BSU15630
Entry
BSU15630          CDS       T00010                                 

Symbol
sirC
Name
(RefSeq) precorrin-2 dehydrogenase
  KO
K24866  precorrin-2 dehydrogenase [EC:1.3.1.76]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU15630 (sirC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BSU15630 (sirC)
SSDB
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Biotin_carb_N
Other DBs
NCBI-GeneID: 938048
NCBI-ProteinID: NP_389446
Pasteur: BG13382
BSORF: BG13382
UniProt: O34813 A0A6M4JG78
Position
1635603..1636091
AA seq 162 aa
MLPLHISLEKKKVVIAGGGSIALRRLKTVISEGADITLVSPDVEPEIKQMAEERRIKWEK
RTIEKEDYLNAFFIIAATDNAAVNKEIAQSASPFQLVNCVSDAELGNVYMPKIVKRGHVT
VSVSTSGASPKHTKELAENVDKLIDGDFVAEVNRLYQMRRKK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcttccgctgcacattagcctggaaaagaagaaggttgtgattgcggggggcggaagc
atcgctctcagaaggctgaaaacggtgatttctgagggagctgatataacgcttgtcagt
ccggatgtggaaccggaaatcaagcaaatggcagaagagcggcgtatcaaatgggaaaaa
cggacaattgaaaaagaagattatctcaatgctttcttcattattgctgcgacggataat
gcggcagtgaacaaagaaattgcccaatccgcttcgccttttcagcttgtcaattgtgtc
agtgacgctgagcttggcaatgtatatatgccgaaaatcgtaaaaagagggcatgtcact
gtgtctgtttctacaagcggagccagtccaaagcacacgaaagagcttgctgaaaacgtg
gataagctgattgacggcgattttgttgctgaagtgaacaggctttatcagatgagaaga
aagaaataa

DBGET integrated database retrieval system