KEGG   Bacillus subtilis subsp. subtilis 168: BSU15650
Entry
BSU15650          CDS       T00010                                 

Gene name
yloB
Definition
(RefSeq) calcium-transporting ATPase
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU15650 (yloB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     BSU15650 (yloB)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 936954
NCBI-ProteinID: NP_389448
Pasteur: BG13384
BSORF: BG13384
UniProt: O34431 A0A6M4JIL0
Position
1637965..1640637
AA seq 890 aa
MKFHEMGQTDLLEATNTSMKQGLTEKEVKKRLDKHGPNELQEGKKTSALLLFFAQFKDFM
VLVLLAATLISGFLGEYVDAVAIIAIVFVNGILGFFQERRAEQSLQALKELSTPHVMALR
EGSWTKIPSKELVPGDIVKFTSGDRIGADVRIVEARSLEIEESALTGESIPVVKHADKLK
KPDVSLGDITNMAFMGTIVTRGSGVGVVVGTGMNTAMGKIADMLESAGTLSTPLQRRLEQ
LGKILIVVALLLTVLVVAVGVIQGHDLYSMFLAGVSLAVAAIPEGLPAIVTVALSLGVQR
MIKQKSIVRKLPAVETLGCASIICSDKTGTMTQNKMTVTHVWSGGKTWRVAGAGYEPKGS
FTLNEKEISVNEHKPLQQMLLFGALCNNSNIEKRDGEYVLDGDPTEGALLTAARKGGFSK
EFVESNYRVIEEFPFDSARKMMTVIVENQDRKRYIITKGAPDVLMQRSSRIYYDGSAALF
SNERKAETEAVLRHLASQALRTIAVAYRPIKAGETPSMEQAEKDLTMLGLSGIIDPPRPE
VRQAIKECREAGIKTVMITGDHVETAKAIAKDLRLLPKSGKIMDGKMLNELSQEELSHVV
EDVYVFARVSPEHKLKIVKAYQENGHIVAMTGDGVNDAPAIKQADIGVSMGITGTDVAKE
ASSLVLVDDNFATIKSAIKEGRNIYENIRKFIRYLLASNVGEILVMLFAMLLALPLPLVP
IQILWVNLVTDGLPAMALGMDQPEGDVMKRKPRHPKEGVFARKLGWKVVSRGFLIGVATI
LAFIIVYHRNPENLAYAQTIAFATLVLAQLIHVFDCRSETSVFSRNPFQNLYLIGAVLSS
ILLMLVVIYYPPLQPIFHTVAITPGDWMLVIGMSAIPTFLLAGSLLTRKK
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgaagtttcatgaaatgggacaaacagatttactagaggcaaccaatacgtccatgaaa
caaggattaacagaaaaagaggtaaaaaaacgccttgacaagcatggaccaaacgagctg
caagaagggaaaaaaacttcagcgcttctcttgtttttcgcgcagttcaaagattttatg
gtgcttgtgcttctggcggcaacgttaatctcaggatttcttggtgaatatgtagatgcg
gttgcgattattgcgattgtgtttgtgaatggcatactcggtttctttcaagaaaggcgt
gctgagcaatctcttcaggctttaaaagagctttcaacaccgcacgtcatggcactcagg
gaaggaagctggacaaagattccttctaaggaactggtgccgggtgatattgtgaaattt
acgagcggggacagaattggcgcagacgttcgaattgttgaagcgagaagccttgaaata
gaagaatcagcgctaaccggggaatcaatcccggttgtgaagcatgctgataaattgaaa
aaaccggatgtttcactcggcgatattaccaatatggcatttatgggtacgattgtgacc
cgcggcagcggtgtcggggttgtcgtcgggacaggaatgaatacggctatggggaaaatt
gccgacatgcttgaatcggcagggacattgtcaaccccgctgcaaagaagactggagcag
ctcgggaagattttgattgttgttgcattgcttctgaccgtacttgtcgttgctgtcggt
gttattcagggtcatgatctgtacagtatgtttttagcaggtgtctcgttagcggtagcc
gctattccggaggggctgccggcgattgtgacagtggcgctttcgcttggtgtacagagg
atgattaaacaaaaatccattgttagaaagcttcctgctgttgaaacgcttgggtgtgcg
tctatcatttgctcagataaaacagggacaatgacccaaaacaaaatgacagtgacgcat
gtctggtccggagggaaaacatggagagtggcaggggccggctatgaaccgaaaggaagc
ttcacactaaacgaaaaagagatcagtgtcaatgaacataagccgcttcagcagatgctt
ctgttcggagcgctttgtaacaactccaatattgagaaaagagacggcgaatatgtgctt
gacggagatccgacagagggagcgctgctcaccgcggcaagaaaaggcggtttttcaaag
gagtttgttgaatctaattacagagtgattgaagaatttccgtttgattccgcacggaaa
atgatgactgtcatcgtagagaatcaagacagaaagcgctatatcattacaaaaggtgcg
ccggatgtactcatgcagcgatcttcccgtatttattatgatggctcagcggctcttttt
tcaaatgaaagaaaagcagaaacagaggcggtattaagacatttggcatcacaggcgctc
agaacgatagcggtcgcctacaggccgataaaagcaggcgaaacaccgtcaatggagcag
gcggaaaaagatctgaccatgcttggcctttcaggtatcattgatcccccgcggccggaa
gtcagacaggcgattaaagaatgccgtgaagcgggaattaagaccgtcatgattacaggt
gatcatgtagaaaccgctaaagcgatagcgaaagacttgcgcctccttccgaaaagcggc
aaaatcatggacggcaagatgctgaatgaactttctcaagaagagctttctcatgtggtg
gaggatgtgtatgtatttgcccgcgtttcccctgaacataaactaaaaatcgtaaaagcc
tatcaggagaacgggcatattgtggcgatgacgggagacggcgtcaatgatgctcctgcc
attaaacaggctgatatcggcgtctctatgggcattaccgggacagatgtggccaaagaa
gcatcatctcttgttctcgtggatgataattttgcgacgattaaatcagcgataaaagaa
ggcaggaacatctacgaaaatatcaggaagtttatcagatacctgttggcgtctaacgtc
ggagaaatccttgtcatgctgtttgcgatgctgcttgcccttcctttaccgctggttccg
attcagattttgtgggtcaacttggtgacggacggattgccggcaatggcgctcggcatg
gatcagccggaaggagacgtcatgaagcgcaagccccgtcatccgaaagaaggggtattt
gcccgcaagctaggatggaaggtcgtttccagaggatttttaatcggagttgccactatt
ttagcgtttatcattgtgtaccaccgcaatccggaaaacttggcttatgcccagacgatc
gcgtttgccacattggtgctcgctcagcttattcacgtgtttgactgccgcagcgaaact
tctgttttctctagaaatccgtttcaaaacctgtatttaatcggcgcggtattgtcatcc
attttgctgatgcttgtagtaatctactatccgccgcttcagccgattttccatactgta
gccatcacgccgggggactggatgctcgtcatcggtatgtccgccatccctacttttttg
ctggcggggtcacttttaacaagaaaaaaataa

DBGET integrated database retrieval system