KEGG   Bacillus subtilis subsp. subtilis 168: BSU15660
Entry
BSU15660          CDS       T00010                                 

Gene name
yloC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: DUF1732 YicC_N Pterin_bind
Other DBs
NCBI-GeneID: 936454
NCBI-ProteinID: NP_389449
Pasteur: BG13385
BSORF: BG13385
UniProt: O34441 A0A6M3ZAI7
Position
1640720..1641595
AA seq 291 aa
MIRSMTGFGSASKTQDDLSVSVELKSVNYRFKEVNARLPRPLLYFEDKLKQTILQHIQRG
RIELFVSVDSDMLVEKRLEIDWPLLDEFVAAARDMKKRYQLSAEPDVMDFFKLDHVVQVH
EEQTQNDKLEALIIDAAEEAVKGLCEMREKEGLLLAKDCLMHIDQLEELVRETELLAADV
VSRYRERLYARIKEWTEDVLDESRLVTECAIFADRSDITEEITRLKSHFAQFRDILASGG
AVGRKLDFLVQELNREANTIGSKANDHQITKLVVEMKSSIEKIKEQVQNIE
NT seq 876 nt   +upstreamnt  +downstreamnt
atgatacgaagtatgacaggcttcggcagtgcaagcaaaacacaagacgatctctctgta
agcgttgaacttaaatctgtgaactacagatttaaagaagtgaacgctcgtttgccaagg
cctttgctatattttgaagataagctgaaacagaccattctgcagcatattcagcgcgga
agaattgagcttttcgtatccgttgacagcgatatgcttgttgagaaaaggcttgaaatt
gattggccgctgctcgatgagtttgtcgcagccgcgagagatatgaagaagcggtatcaa
ttgtctgcagagcccgatgtaatggatttctttaagcttgatcatgtcgtccaggttcat
gaagaacagacgcaaaatgacaagctggaggcgttgatcatcgatgctgcagaagaagcg
gtaaaaggtctctgtgaaatgcgtgaaaaagaggggctgctcttagcgaaagactgcctg
atgcatattgatcagcttgaagagctggtgagagaaactgaattgctggctgcagatgtc
gtatctcgttaccgggaacggctgtatgccagaatcaaagaatggactgaagacgtatta
gacgagagccggcttgtaacagaatgcgctatttttgcagaccgctctgatatcactgaa
gagattacaaggctgaagagccacttcgcccagtttcgtgatatattagctagtggcgga
gctgtcgggcgcaaactcgactttcttgttcaggagctcaatcgggaagcaaatacgatc
ggctcaaaagcaaatgatcatcagatcacaaagcttgtcgttgaaatgaaaagttctatt
gaaaaaataaaagaacaagtgcaaaatatagaatag

DBGET integrated database retrieval system