KEGG   Bacillus subtilis subsp. subtilis 168: BSU15670
Entry
BSU15670          CDS       T00010                                 

Symbol
ylzA
Name
(RefSeq) hypothetical protein
  KO
K09777  extracellular matrix regulatory protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU15670 (ylzA)
SSDB
Motif
Pfam: DUF370
Other DBs
NCBI-GeneID: 937956
NCBI-ProteinID: NP_570902
Pasteur: BG14185
BSORF: BG14185
UniProt: Q7WY72 A0A6M4JI06
Position
1641672..1641941
AA seq 89 aa
MTIKLINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYGRRTRAVVVMDS
DHIILSAVQPETVAHRLSVKEEIMDEGQG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgacgattaaactgattaatatcggatttggcaatatcatctccgccaatcggatgatt
tcgattgtcagcccggagtctgcgccaatcaaacggatgattcaggatgcaagagaccgc
ggaatgctaattgacgctacatacggacgaagaacccgtgcagttgtcgtcatggatagt
gatcacattatcttatctgccgtccagcctgagacagttgcacacagactttctgttaaa
gaagaaattatggatgaagggcaggggtaa

DBGET integrated database retrieval system