KEGG   Bacillus subtilis subsp. subtilis 168: BSU15690
Entry
BSU15690          CDS       T00010                                 

Symbol
rpoZ
Name
(RefSeq) DNA-directed RNA polymerase subunit omega
  KO
K03060  DNA-directed RNA polymerase subunit omega [EC:2.7.7.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    BSU15690 (rpoZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU15690 (rpoZ)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU15690 (rpoZ)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     BSU15690 (rpoZ)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     BSU15690 (rpoZ)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      BSU15690 (rpoZ)
SSDB
Motif
Pfam: RNA_pol_Rpb6
Other DBs
NCBI-GeneID: 936419
NCBI-ProteinID: NP_389451
Pasteur: BG13387
BSORF: BG13387
UniProt: O35011 A0A6M4JGK7
Position
1642567..1642770
AA seq 67 aa
MLDPSIDSLMNKLDSKYTLVTVSARRAREMQIKKDQMIEHTISHKYVGKALEEIDAGLLS
FEKEDRE
NT seq 204 nt   +upstreamnt  +downstreamnt
atgttagatccgtcaattgattctttaatgaataaattagattcaaaatatacgctggtg
actgtttctgcgagacgtgcccgtgaaatgcaaatcaaaaaagaccaaatgattgaacat
acgatttcacacaaatatgtaggcaaagctttagaagaaattgatgcaggcctgctttcg
tttgaaaaggaagaccgcgaatag

DBGET integrated database retrieval system