KEGG   Bacillus subtilis subsp. subtilis 168: BSU15700Help
Entry
BSU15700          CDS       T00010                                 

Gene name
coaBC
Definition
(RefSeq) coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
Module
bsu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU15700 (coaBC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BSU15700 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BSU15700 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_7 ATPgrasp_N
Motif
Other DBs
NCBI-GeneID: 938487
NCBI-ProteinID: NP_389452
Pasteur: BG13388
BSORF: BG13388
UniProt: O35033
Position
1642851..1644071
Genome map
AA seq 406 aa AA seqDB search
MLNNRNVLLCVSGGIAVYKACALTSKLVQAGANVKVIMTESACRFVSPLTFQALSRHEVY
TDTFKEQNPSVISHIDAADWADLIIVAPATANVIGKLANGIADDMLTTTLLAATAPVWIA
PAMNVHMYDHPAVKRNISVLYQDGYCFIEPSEGYLACGYVGKGRLEEPENIVKLAEKHFA
EETSAPLEGKHVVITAGPTREAIDPVRFFTNKSTGKMGYALAEAAVQLGARVILISGPVS
LDQPKGLAEFIPVQSAADMREAVLSVYDASDIVIKTAAVADFTPKTVFDHKMKKQDGGMT
LELKRTVDILKELGEKKKEQILVGFAAETQDIEHYARKKLAAKNLDLIVANDVKANGAGF
GADTNIVTIFFKDGHKRELPIMSKLDVSFEILQEIAALSKQTGERS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgcttaacaatcgaaatgtgttactttgcgtgagtggaggcatcgctgtttataaagcc
tgtgcgttaacgagcaagctggttcaggcaggagcaaatgtcaaagtgattatgactgaa
tccgcttgccgattcgtttcaccgctgacatttcaggcattgagccgccacgaagtctat
acagatacatttaaagaacaaaatccaagcgtcatttctcatattgatgccgcagactgg
gccgacttgattatcgtagcgccggctacggctaatgtgattggaaaactggcaaacggc
atcgctgatgatatgctgacgacaacattgttggcagcaacggctcccgtttggatcgcg
ccggcaatgaacgttcatatgtatgaccacccggcagtcaaacgaaacatttctgttctt
tatcaggacggttattgttttattgagccaagtgagggctatttagcatgcggttacgta
ggaaaaggcagattggaagagccggaaaacatcgtaaagctggccgaaaaacattttgct
gaagaaacatccgctcctttagaaggcaagcatgtggtcattacagccggcccaacgcgg
gaagcgattgatcctgtccggttttttaccaataaatcgacgggcaaaatgggctacgca
ctggcggaggctgctgttcagctcggcgcacgggtaatcttaatttctgggcctgtttca
cttgatcagcctaaaggccttgctgagtttatccctgttcaatcggctgcggatatgcgc
gaagctgtgctctctgtgtatgacgcaagcgatatagtcattaaaacagctgcggtagcc
gattttacgccgaaaacagtatttgaccataaaatgaaaaaacaagacggcggcatgacc
ttagaactgaaaagaacagtcgatattttgaaagaattgggcgagaaaaagaaagagcag
attttggtcggatttgccgccgaaacacaagacattgaacactatgcacgtaaaaagctc
gccgctaaaaaccttgatttgattgtggcaaatgatgtgaaagcaaatggggccggtttt
ggtgctgatacgaatatcgtgacaatctttttcaaagacgggcataaacgcgaactcccg
attatgtctaagctcgatgtttcttttgaaatccttcaggagatcgcagccctctcaaaa
caaaccggagagcgctcatga

DBGET integrated database retrieval system