KEGG   Bacillus subtilis subsp. subtilis 168: BSU15720
Entry
BSU15720          CDS       T00010                                 

Symbol
def
Name
(RefSeq) peptide deformylase
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU15720 (def)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     BSU15720 (def)
SSDB
Motif
Pfam: Pep_deformylase
Other DBs
NCBI-GeneID: 938819
NCBI-ProteinID: NP_389454
Pasteur: BG11933
BSORF: BG11933
UniProt: P94462 A0A6M3ZB20
Position
1646512..1646994
AA seq 160 aa
MAVKKVVTHPAEVLETPAETVTVFDKKLKKLLDDMYDTMLEMDGVGLAAPQIGILKRAAV
VEIGDDRGRIDLVNPEILEKSGEQTGIEGCLSFPNVYGDVTRADYVKVRAFNRQGKPFIL
EARGFLARAVQHEMDHLDGVLFTSKISKYYTEDELADMEG
NT seq 483 nt   +upstreamnt  +downstreamnt
ttggcagtaaaaaaggtcgtcacacatcctgcggaggttttggaaacacctgcggaaacc
gtgactgtttttgataaaaagctaaaaaaactgcttgatgatatgtacgacaccatgctt
gaaatggatggtgtcggactggcagcgccgcaaatcggcattttaaaaagagcggccgtc
gtagaaatcggggatgacagagggagaattgatctcgttaatcctgaaattttagaaaaa
agcggcgagcaaaccggaattgaaggatgcttgagctttcctaacgtctatggtgatgtc
acacgtgccgattatgtcaaagtgcgtgcgtttaaccgtcagggaaaaccgttcattctg
gaagcgcgaggctttttagcaagagccgtgcagcatgaaatggaccacttagacggtgtg
ctgtttacatctaaaataagtaaatactatacagaagatgaactagcggatatggaagga
tga

DBGET integrated database retrieval system