KEGG   Bacillus subtilis subsp. subtilis 168: BSU15730
Entry
BSU15730          CDS       T00010                                 

Gene name
fmt
Definition
(RefSeq) methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00670  One carbon pool by folate
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU15730 (fmt)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU15730 (fmt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     BSU15730 (fmt)
Motif
Pfam: Formyl_trans_N Formyl_trans_C DUF4911
Other DBs
NCBI-GeneID: 936571
NCBI-ProteinID: NP_389455
Pasteur: BG11937
BSORF: BG11937
UniProt: P94463 A0A6M4JG85
Position
1646999..1647952
AA seq 317 aa
MTRIVFMGTPDFSVPVLRTLIEDGYEVVGVVTQPDRPKGRKKVLTPPPVKEEALRHGIPV
LQPEKVRLTEEIEKVLALKPDLIVTAAFGQILPKELLDSPKYGCINVHASLLPELRGGAP
IHYSILQGKKKTGITIMYMVEKLDAGDMISKVEVDIEETDNVGTLHDKLSVAGAKLLSET
VPNVIAGSISPEKQDEEKATYAPNIKREQELLDWSRTGEELYNQIRGLNPWPVAYTTLNG
QNLKIWASKKIAAPTTAEPGTVVAVEKEGIIVATGNETALLLTELQPAGKKRMKGEDFVR
GAHVEAGDVLGVNNEKN
NT seq 954 nt   +upstreamnt  +downstreamnt
atgacgagaatcgtatttatgggaacgccggatttttcagttcctgttttaagaaccctg
atagaggacggatatgaagtagtgggggtcgtcacacagccggaccgtccgaagggcaga
aaaaaagtactgacacctcctccggtaaaggaagaggcattgcgccacggcatcccggtt
cttcagccggaaaaagtcagattgacagaagaaattgaaaaagtgctggcattaaagcct
gacctgattgtaacggcggcattcggacaaattttgcctaaagagcttctcgacagtcca
aaatacggctgcattaacgttcacgcatcccttttgccggaactgcgcggcggtgctccg
atccattattccattctgcagggaaagaagaaaaccgggattaccattatgtatatggta
gaaaaattggatgcgggcgatatgatctcaaaagtggaagtggacattgaagaaaccgac
aatgtcggaacactgcacgataaattaagcgttgctggcgcgaagctattgtctgaaacg
gttccaaacgttattgccggcagcatatcacctgaaaagcaggatgaagagaaagcgacg
tacgcgcctaacattaaaagagagcaagagctgctcgactggtccagaacgggcgaagag
ctttacaaccagatccgcggcttaaatccatggcctgttgcttatacgactctaaacgga
caaaacttgaaaatatgggcgtcgaaaaaaatagcggcaccaacaacagctgagcccggc
acagtcgttgcagttgaaaaggaaggaattatcgttgccacaggtaacgagacggctctg
ttattaaccgaactccagccggcaggcaaaaaacgaatgaaaggcgaagactttgtgcga
ggcgctcatgttgaagccggtgatgtgttaggagtaaacaatgaaaaaaactag

DBGET integrated database retrieval system