KEGG   Bacillus subtilis subsp. subtilis 168: BSU15740
Entry
BSU15740          CDS       T00010                                 

Symbol
rsmB
Name
(RefSeq) 16S rRNA m5C967 methyltransferase
  KO
K03500  16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU15740 (rsmB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     BSU15740 (rsmB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BSU15740 (rsmB)
SSDB
Motif
Pfam: Methyltr_RsmB-F NusB Methyltransf_31 FtsJ Methyltransf_25 Methyltr_RsmF_N Methyltransf_11 Ubie_methyltran Methyltransf_24
Other DBs
NCBI-GeneID: 938106
NCBI-ProteinID: NP_389456
Pasteur: BG12253
BSORF: BG12253
UniProt: P94464 A0A6M3ZAM9
Position
1647939..1649282
AA seq 447 aa
MKKTSVRDIALEALIKLEQNQAYSNLLLKSVIKSNELSDQNRGLLTELVYGTLQNKIALD
YMLKPFINKPQKVKPWVIQLLRLSLYQMEYLEKIPDRAAIHEAVEIAKIRGHKGIASFVN
GVLRSIQREGVPSFDAIEDPVRRLATETSHPEWLVKEWADAYGFEAAEKICRIHLIPPKQ
TLRVNQMKADRAELLDQMAAEGIEVEKGDLAEDAVKLLKGTIAGTHFFQNGEVSIQDESS
MLVARALDPKSDETVLDACAAPGGKSAHIAELMKNKGSVTSLDLHKHKVKLIKEAADRLG
LTIIHAETMDARKAGETFENEQFDRILVDAPCSGFGVIRRKPDMKYTKKPDDSARLAEIQ
LSILREIAPLVKKGGTLVYSTCTMDRTENDEVIHAFIQEHPDFEPDLSLEKRLPEKVRPF
VRDGRLQILPHYFGTDGFFICSMRKKG
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaaaaaaactagtgttcgtgacatcgcccttgaggcgctgatcaaattagaacaaaac
caggcatacagcaacctgctgctgaaatcggtcattaaatcaaatgaactgagtgatcag
aacagagggcttttgactgaacttgtctatggtacattacaaaataagatcgcgcttgat
tatatgcttaaaccgtttatcaataagcctcaaaaggtaaagccgtgggtgattcagctt
cttcgcctatccttatatcaaatggagtatttggagaagattccagacagggcagccatt
catgaagcggttgagattgctaaaatccgcggacacaaaggcattgcttcatttgtcaac
ggcgtgctccgttctattcagcgcgaaggtgttccatcctttgacgcgatcgaagatcct
gtccgccggctggcgacagaaacaagccatccggaatggcttgtgaaagagtgggcggat
gcgtatggatttgaagctgcggaaaagatttgccgcatccatctcattccgccgaaacag
acgctgcgtgtcaatcaaatgaaagcagacagagctgagctgcttgaccaaatggctgct
gagggaatcgaagttgaaaaaggcgacctcgctgaagatgctgtgaagctcttaaaggga
acaattgccggaactcatttcttccaaaacggcgaagtttctatccaggatgagagctcc
atgctcgtcgcccgcgcccttgatcctaagtcagatgaaacagtgcttgacgcgtgtgcg
gcgcctggcggaaagtcggctcatatcgcagaattaatgaagaacaaggggagcgttacg
tcgcttgatcttcacaaacataaagtgaagctgatcaaagaagcggcagatcggcttggc
ctgacaatcattcatgcggaaacaatggatgctagaaaagcgggggaaacgtttgaaaac
gaacagtttgaccgaatattggtcgatgccccgtgctcaggtttcggtgttatcagaaga
aagccggacatgaaatacacgaaaaaacctgacgacagcgcccgtctagctgaaatccag
ctgtcgatcttgagggaaatcgcaccattagtaaaaaaaggtggcactcttgtctacagt
acgtgtacaatggaccggacagaaaatgatgaagtaatacatgcgtttatacaagaacat
cctgattttgaacccgatttgtctcttgaaaagcggctgcctgaaaaggtgagacccttt
gttcgggatggaaggcttcaaatccttcctcattatttcggaacagatggtttctttatt
tgcagcatgagaaagaagggataa

DBGET integrated database retrieval system