KEGG   Bacillus subtilis subsp. subtilis 168: BSU15750
Entry
BSU15750          CDS       T00010                                 

Symbol
yloN
Name
(RefSeq) 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN
  KO
K06941  23S rRNA (adenine2503-C2)-methyltransferase [EC:2.1.1.192]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU15750 (yloN)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.192  23S rRNA (adenine2503-C2)-methyltransferase
     BSU15750 (yloN)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU15750 (yloN)
SSDB
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12 Radical_SAM_2
Other DBs
NCBI-GeneID: 936310
NCBI-ProteinID: NP_389457
Pasteur: BG13389
BSORF: BG13389
UniProt: O34617 A0A6M3ZAM7
Position
1649286..1650377
AA seq 363 aa
MAELNKTKVRKELRTERPSIYSFELDEIKQWLTDNGEKPFRAAQIFEWLYEKRVSSFEDM
TNLSKDLREKLNTRFVLTTLKTAVKQTSQDGTMKFLFELHDGYTIETVLMRHEYGNSVCV
TTQVGCRIGCTFCASTLGGLKRNLEAGEIVAQVVKVQKALDETDERVSSVVIMGIGEPFD
NFNEMLAFLKIINHDKGLNIGARHITVSTSGIIPKIYEFADQQMQINFAISLHAPNTEIR
SRLMPINRAYKLPDLMEAVKYYINKTGRRISFEYGLFGGVNDQVEHAEELADLLEGVKCH
VNLIPVNYVPERDYVRTPRDQIFAFEKTLKSRGVNVTIRREQGHDIDAACGQLRAKERQD
ETR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcagaacttaataaaacaaaagtaagaaaagaattgcggacagagcgtccgtctatt
tattcttttgaattagatgaaatcaaacaatggctgacagacaatggagagaaaccgttc
cgtgcagcccagatctttgaatggctatatgaaaaacgcgtatcttcttttgaagatatg
acaaacctctcaaaggatctgcgtgagaaattaaacactcgctttgtgttaacaacgctg
aaaacggctgttaaacaaacctctcaagacggtacgatgaagtttttgtttgagcttcat
gacggttataccatcgaaaccgttttaatgagacacgagtatggcaattctgtatgtgta
acgacacaagtcggctgccgtattggctgcacattctgcgcgtcaacgcttggaggctta
aaacgaaaccttgaagcaggggaaattgtcgctcaagtagtcaaagtgcaaaaagctctt
gatgaaacggatgaacgcgtcagctctgtcgtgatcatgggaatcggcgaaccttttgat
aactttaacgaaatgctcgctttcttgaaaatcattaaccatgacaagggcctgaatatc
ggtgctcgccatattacggtctctacgagtggaatcatcccgaaaatttacgaatttgct
gatcagcaaatgcagattaactttgcaatttctctgcacgcgccgaacacagaaatcaga
agccgtttgatgccgattaacagagcatataaactgcctgatctaatggaagccgttaaa
tattatattaataaaacaggacgccgtatcagctttgaatacgggctgttcggaggcgta
aacgaccaggtggaacacgccgaagagcttgccgacttgctggaaggagtcaaatgccac
gtgaacttgattccggtaaactacgtgcctgaacgggactatgtgcgcacaccgcgtgat
cagatttttgcttttgaaaaaacgctgaaatcccgcggagtaaatgtcacaatccgaaga
gagcaaggacatgacattgacgcagcctgcggtcagcttcgcgcgaaggagcgtcaagac
gagacgaggtga

DBGET integrated database retrieval system