KEGG   Bacillus subtilis subsp. subtilis 168: BSU15760
Entry
BSU15760          CDS       T00010                                 

Symbol
prpC
Name
(RefSeq) protein phosphatase PrpC
  KO
K20074  PPM family protein phosphatase [EC:3.1.3.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bsu01009]
    BSU15760 (prpC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BSU15760 (prpC)
Protein phosphatases and associated proteins [BR:bsu01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    BSU15760 (prpC)
SSDB
Motif
Pfam: PP2C_2 PP2C SpoIIE
Other DBs
NCBI-GeneID: 935931
NCBI-ProteinID: NP_389458
Pasteur: BG13390
BSORF: BG13390
UniProt: O34779 A0A6M3ZAK2
Position
1650384..1651148
AA seq 254 aa
MLTALKTDTGKIRQHNEDDAGIFKGKDEFILAVVADGMGGHLAGDVASKMAVKAMGEKWN
EAETIPTAPSECEKWLIEQILSVNSKIYDHAQAHEECQGMGTTIVCALFTGKTVSVAHIG
DSRCYLLQDDDFVQVTEDHSLVNELVRTGEISREDAEHHPRKNVLTKALGTDQLVSIDTR
SFDIEPGDKLLLCSDGLTNKVEGTELKDILQSDSAPQEKVNLLVDKANQNGGEDNITAVL
LELALQVEEGEDQC
NT seq 765 nt   +upstreamnt  +downstreamnt
ttgttaacagccttaaaaacagatacaggaaaaatccgccagcataatgaagatgatgcg
gggatattcaaggggaaagatgaatttatattagcggttgtcgctgatggcatgggcggc
catcttgctggagatgttgcgagcaagatggctgtgaaagccatgggggagaaatggaat
gaagcagagacgattccaactgcgccctcggaatgtgaaaaatggctcattgaacagatt
ctatcggtaaacagcaaaatatacgatcacgctcaagcccacgaagaatgccaaggcatg
gggacgacgattgtatgtgcactttttacggggaaaacggtttctgttgcccatatcgga
gacagcagatgctatttgcttcaggacgatgatttcgttcaagtgacagaagaccattcg
cttgtaaatgaactggttcgcactggagagatttccagagaagacgctgaacatcatccg
cgaaaaaatgtgttgacgaaggcgcttggaacagaccagttagtcagtattgacacccgt
tcctttgatatagaacccggagacaaactgcttctatgttctgacggactgacaaataaa
gtggaaggcactgagttaaaagacatcctgcaaagcgattcagctcctcaggaaaaagta
aacctgcttgtggacaaagccaatcagaatggcggagaagacaacattacagcagttttg
cttgagcttgctttacaagttgaagagggtgaagatcagtgctaa

DBGET integrated database retrieval system