KEGG   Bacillus subtilis subsp. subtilis 168: BSU15780Help
Entry
BSU15780          CDS       T00010                                 

Gene name
yloQ
Definition
(RefSeq) ribosome biogenesis GTPase RsgA
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU15780 (yloQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU15780 (yloQ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     BSU15780 (yloQ)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     BSU15780 (yloQ)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  GTPases
   BSU15780 (yloQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgA_GTPase RsgA_N MMR_HSR1 AAA_23 GTP_EFTU AAA_29 ABC_tran SMC_N FeoB_N AAA_16 eIF-1a AAA_15 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 938451
NCBI-ProteinID: NP_389460
Pasteur: BG13392
BSORF: BG13392
UniProt: O34530
Structure
PDB: 

Position
1653103..1653999
Genome map
AA seq 298 aa AA seqDB search
MPEGKIIKALSGFYYVLDESEDSDKVIQCRGRGIFRKNKITPLVGDYVVYQAENDKEGYL
MEIKERTNELIRPPICNVDQAVLVFSAVQPSFSTALLDRFLVLVEANDIQPIICITKMDL
IEDQDTEDTIQAYAEDYRNIGYDVYLTSSKDQDSLADIIPHFQDKTTVFAGQSGVGKSSL
LNAISPELGLRTNEISEHLGRGKHTTRHVELIHTSGGLVADTPGFSSLEFTDIEEEELGY
TFPDIREKSSSCKFRGCLHLKEPKCAVKQAVEDGELKQYRYDHYVEFMTEIKDRKPRY
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagggcaaaattattaaggcgctaagcggcttttactatgtactggatgaatca
gaggattcagataaagtaatacaatgcagaggaagaggcattttcagaaaaaacaaaatt
acccctcttgtcggtgattacgttgtgtatcaagctgaaaatgacaaagaaggatatcta
atggaaattaaagaaagaaccaacgagcttatcaggccgccaatttgcaacgttgatcaa
gcggtccttgttttctcagcggttcagccttctttcagcacggcattgctcgaccgcttc
ctggttctcgttgaggccaatgatattcagccgattatatgcattactaaaatggatctg
attgaagatcaagatacagaagatacgatacaagcctatgcagaagactatcggaatatt
ggttatgacgtataccttacctcctctaaggaccaagatagtttagcggacatcatcccg
cattttcaggataaaacaacggtatttgccggtcagtccggtgttgggaaatcctcgctt
ctcaacgcgatcagtccggagctcggattaagaacaaacgagatttccgagcatttgggc
cgcgggaaacacacaacccgccacgtggagctgattcacacgtccggaggtttggttgca
gatacaccgggattcagctcgcttgaatttacagacattgaggaagaagagctgggctat
accttccctgatatcagagaaaaaagctcttcatgcaaatttagaggctgtttacatctg
aaagagccgaaatgtgcggtgaaacaagctgttgaagacggggaattaaagcagtatcgc
tatgaccattatgttgaatttatgacggagattaaagacagaaagccgaggtattag

DBGET integrated database retrieval system