KEGG   Bacillus subtilis subsp. subtilis 168: BSU15790
Entry
BSU15790          CDS       T00010                                 

Symbol
rpe
Name
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU15790 (rpe)
   00040 Pentose and glucuronate interconversions
    BSU15790 (rpe)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     BSU15790 (rpe)
SSDB
Motif
Pfam: Ribul_P_3_epim OMPdecase QRPTase_C
Other DBs
NCBI-GeneID: 936393
NCBI-ProteinID: NP_389461
Pasteur: BG13393
BSORF: BG13393
UniProt: O34557 A0A6M4JGL5
Position
1654004..1654657
AA seq 217 aa
MIKVAPSILSADFAALGNEIKDVEKGGADCIHIDVMDGHFVPNITIGPLIVEAVRPVTDL
PLDVHLMIEEPDRYIPAFAKAGADILSVHAEACPHLHRTIQLIKEQGVKAGVVLNPHTPV
QVIEHVFDDLDLVLLMTVNPGFGGQKFIHSVLPKIKEVKRMADEKGKKDLLIEVDGGVNK
ETAPLVIEAGANLLVAGSAVYGQSDRKKAISEIRGSK
NT seq 654 nt   +upstreamnt  +downstreamnt
atgataaaggttgcaccatctattctttccgctgattttgccgctttaggcaatgagatt
aaagatgtagaaaaaggcggagccgattgtattcatattgatgttatggacggccatttt
gtcccgaatatcacaatcggtccgctgattgtagaagcggtccggccggtaacggatctg
ccgcttgatgtccatttaatgatagaagagccggatcgttatatcccggcttttgcgaaa
gcaggcgcagatatcctgtctgtgcatgctgaggcatgtccgcacctgcaccgtaccatc
cagctcattaaagagcaaggagtgaaggccggagtagttctaaacccgcatacccctgta
caagtcatcgaacatgttttcgacgatcttgatcttgttcttttaatgacggtgaacccg
ggcttcggcgggcagaaatttattcattcagtccttcctaaaataaaagaggttaagcga
atggcggatgaaaaaggaaaaaaagatctgttaattgaagtagacggcggcgtcaacaaa
gaaaccgctccgctcgtcattgaagcgggcgcaaatttactcgttgccggttcagctgtt
tatggccagtctgaccgcaaaaaagcaatttctgaaatcagaggaagtaaataa

DBGET integrated database retrieval system