KEGG   Bacillus subtilis subsp. subtilis 168: BSU15800
Entry
BSU15800          CDS       T00010                                 

Symbol
thiN
Name
(RefSeq) thiamine pyrophosphokinase
  KO
K00949  thiamine pyrophosphokinase [EC:2.7.6.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU15800 (thiN)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.2  thiamine diphosphokinase
     BSU15800 (thiN)
SSDB
Motif
Pfam: TPK_catalytic TPK_B1_binding
Other DBs
NCBI-GeneID: 937714
NCBI-ProteinID: NP_389462
Pasteur: BG13394
BSORF: BG13394
UniProt: O34664 A0A6M4JMX0
Structure
PDB: 
3LM8

Position
1654730..1655374
AA seq 214 aa
MKTINIVAGGPKNLIPDLTGYTDEHTLWIGVDKGTVTLLDAGIIPVEAFGDFDSITEQER
RRIEKAAPALHVYQAEKDQTDLDLALDWALEKQPDIIQIFGITGGRADHFLGNIQLLYKG
VKTNIKIRLIDKQNHIQMFPPGEYDIEKDENKRYISFIPFSEDIHELTLTGFKYPLNNCH
ITLGSTLCISNELIHSRGTFSFAKGILIMIRSTD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaaaacaattaatatcgttgcgggaggcccgaaaaatctcattcccgatctaaccggc
tatacggatgaacacacgctttggatcggtgttgacaaaggcaccgtcactctcttagat
gccgggatcattcctgttgaagccttcggagattttgacagcataacggagcaagaacgc
cggcgaatagaaaaagccgctcccgcccttcatgtgtatcaagcagaaaaagatcaaaca
gatttagacctcgcccttgattgggcgctggaaaagcagccggatattattcagattttc
ggcattacaggcggcagagctgatcattttttaggaaacattcagcttctgtataaaggt
gtaaaaacgaacataaaaattaggctgatagacaaacaaaatcatattcaaatgttccct
cctggtgaatatgatattgagaaggatgaaaataagcgatatatctccttcataccgttt
tccgaagacatacatgagctgaccctgaccggttttaaatatcctctaaataattgtcat
attacgctcggttcaacactatgtattagtaacgaactcattcattcacgaggtactttt
tcgtttgcaaaaggcatattaataatgataagaagcacggattaa

DBGET integrated database retrieval system