KEGG   Bacillus subtilis subsp. subtilis 168: BSU15820
Entry
BSU15820          CDS       T00010                                 

Symbol
rpmB
Name
(RefSeq) 50S ribosomal protein L28
  KO
K02902  large subunit ribosomal protein L28
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU15820 (rpmB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU15820 (rpmB)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU15820 (rpmB)
  Bacteria
    BSU15820 (rpmB)
SSDB
Motif
Pfam: Ribosomal_L28
Other DBs
NCBI-GeneID: 938067
NCBI-ProteinID: NP_389464
Pasteur: BG10777
BSORF: BG10777
UniProt: P37807 A0A6M4JLS1
Position
complement(1655599..1655787)
AA seq 62 aa
MARKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKPKKVYVSARALKSGKVE
RV
NT seq 189 nt   +upstreamnt  +downstreamnt
atggcacgtaaatgcgttatcacaggtaaaaaaacaacagctgggaataaccgttctcac
gcaatgaacgcttctaagcgcacttggggcgcgaatcttcaaaaggttcgtatccttgtg
aacggaaaacctaaaaaagtatatgtatctgctcgagctttgaaatccggtaaagttgag
cgtgtataa

DBGET integrated database retrieval system