KEGG   Bacillus subtilis subsp. subtilis 168: BSU15830
Entry
BSU15830          CDS       T00010                                 

Symbol
yloU
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Asp23 ZT_dimer
Other DBs
NCBI-GeneID: 937855
NCBI-ProteinID: NP_389465
Pasteur: BG13395
BSORF: BG13395
UniProt: O34318 A0A6M3ZB26
Position
1656064..1656426
AA seq 120 aa
MSIELRTKYGQIDISNEVIAMVAGGAAVDCYGIVGMASKNQIKDGLTEILRKENFSRGVQ
VRQEGEQIHIDMYIIVSYGTKISEVAHNVQTKVKYTVNQTIGLAVDSVNIYVQGVRVTNP
NT seq 363 nt   +upstreamnt  +downstreamnt
gtgtccattgaattaagaacgaagtacggacagattgatatatctaatgaagtcatcgcg
atggttgcaggaggcgcggcggttgactgttacggcattgtcggcatggcctctaaaaac
cagattaaagacggactgactgaaatccttcggaaagagaatttcagcaggggtgtccaa
gttcgccaagaaggagaacagatacatatcgacatgtatatcattgtcagctacggcacg
aaaatttctgaagtggcacataatgtccaaacaaaagtaaagtacacagtaaatcaaacc
atcggactggcagtggattctgtcaatatttatgtccaaggcgtacgagtgacgaacccg
tag

DBGET integrated database retrieval system