KEGG   Bacillus subtilis subsp. subtilis 168: BSU15840
Entry
BSU15840          CDS       T00010                                 

Gene name
yloV
Definition
(RefSeq) hypothetical protein
  KO
K07030  fatty acid kinase [EC:2.7.2.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU15840 (yloV)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.18  fatty acid kinase
     BSU15840 (yloV)
Motif
Pfam: Dak1_2 Dak2
Other DBs
NCBI-GeneID: 937917
NCBI-ProteinID: NP_389466
Pasteur: BG13396
BSORF: BG13396
UniProt: O34751 A0A6M3ZAW9
Position
1656442..1658103
AA seq 553 aa
MSIRTLDGRTFAEMILAGAQNLSQNASAVDALNVFPVPDGDTGTNMNLSMTSGAREVEQM
DTDDIGKVGSALSKGLLMGARGNSGVILSQLFRGFSKNIETKKEINALEFAAALQAGVDM
AYKAVMKPVEGTILTVAKDAAKKAMILAEKETDITALMTAVTEEAEASLNRTPELLPVLK
EVGVVDSGGKGLLCVYEGFLASLKGETVPQKAVLPSLDDMVSAEHHKSAQSMMNTEDIEF
GFCTEVMVRLDQTKREFDEGTFRQDLSQFGDSLLVIADESLAKVHIHAEEPGNVLNYAQH
YGELIKIKIENMREQHTSIISQESKPADNETPPAKQPYGIVTVAMGEGIADLFKSIGASV
VIEGGQTMNPSTEDIVDAVKSVNADTVFILPNNSNIIMAANQAASVVDEQVFVIPAKTVP
QGMSALLAFNPDQEAEANEANMLSAIQQVKSGQVTFSVRDTHIDGKDIKKGDFMGILNGT
IIGTSENQLSAAKMLLSEMIGEDDEIVTILYGEDASQEEAEQLEAFLSEKYEEIEVEIHN
GKQPLYSYIVSAE
NT seq 1662 nt   +upstreamnt  +downstreamnt
ttgtctatcagaacattagacggcagaacctttgccgagatgattcttgcgggagcgcag
aatctgtctcaaaacgccagtgcagttgatgcactgaacgtgttcccggtgccggacggt
gatacgggaacaaatatgaacctgtcgatgacttccggagcaagagaagttgaacaaatg
gatacggatgatatcgggaaggtgggctccgcgttatctaaagggctgctcatgggagca
cgcggaaattcaggagttatcctatcccaattgttccgcggatttagcaaaaacattgaa
acgaaaaaagaaattaatgcacttgagtttgccgctgcgctgcaagcaggtgtagacatg
gcgtataaagctgtcatgaaacctgtagagggcaccattttaacagttgcaaaagacgct
gcaaaaaaagcaatgatcttagcagaaaaagaaaccgatatcactgcgctgatgactgca
gtgacagaagaagcagaggcgtctttaaaccgcacccctgaattgctacctgtcctaaag
gaagtaggagttgtcgatagcgggggcaaaggcctgctctgtgtgtatgaaggtttcctt
gcttcattaaaaggtgaaactgtacctcagaaagcagttcttccgtcacttgacgacatg
gtcagcgcagagcatcacaagagcgcgcaaagcatgatgaataccgaagatattgaattt
ggattctgtaccgaagtgatggttaggcttgatcagacaaaaagagagttcgacgaaggc
acgttcaggcaagacctcagccagttcggagattctctgcttgtgattgcggatgaatcg
ctggcgaaggttcatattcatgctgaagagccgggaaacgtgttaaactacgcccagcat
tacggtgaattgatcaaaataaaaatagaaaatatgagagaacagcatacctctatcatc
agtcaagaaagcaaacctgcagacaacgaaacaccgccggcaaaacagccgtatggcatt
gtgactgtagcgatgggagaaggaattgcagacctatttaaaagcattggcgcttctgtt
gtgattgaaggcggccagaccatgaacccaagcactgaggatattgttgatgccgtgaag
tctgtaaatgcagatacggtatttatcctgcctaacaactccaacattatcatggctgct
aaccaagcggccagcgtagtggatgaacaggtttttgtcattcctgctaaaacggttccg
caagggatgtcagctctgctggcttttaacccggatcaagaagctgaagcgaacgaggcc
aatatgctaagcgccattcagcaagtaaaaagcggacaggtgacgttctcagtcagagat
actcatattgacggtaaagacattaaaaaaggcgactttatgggcattctgaatggaacg
attatcggcacttctgaaaatcagctgtcagccgcgaaaatgctgctgtcagaaatgatc
ggagaagatgatgaaatcgtgaccattctatatggtgaggatgcgtctcaggaagaagct
gagcagcttgaagcgtttctcagtgaaaagtacgaggagattgaggttgagatccacaat
gggaaacagcctctgtattcgtatatagtttcagcagaatag

DBGET integrated database retrieval system