KEGG   Bacillus subtilis subsp. subtilis 168: BSU15850
Entry
BSU15850          CDS       T00010                                 

Symbol
sdaAB
Name
(RefSeq) L-serine dehydratase, beta chain
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU15850 (sdaAB)
   00270 Cysteine and methionine metabolism
    BSU15850 (sdaAB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     BSU15850 (sdaAB)
SSDB
Motif
Pfam: SDH_beta ACT PGDH_inter ACT_4
Other DBs
NCBI-GeneID: 935964
NCBI-ProteinID: NP_389467
Pasteur: BG13397
BSORF: BG13397
UniProt: O34635 A0A6M3ZAP2
Position
1658242..1658904
AA seq 220 aa
MKYRSVFDIIGPVMIGPSSSHTAGAARIGRVARSLFGREPERIIVSFYGSFAETYKGHGT
DVAIIGGLLDFDTFDERIKTAIQIAEAKGIDIEFRVEDAVPVHPNTAKITISDEKGELEL
TGISIGGGKIEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVA
RKDIGQLALMTIEVDQNIDDHILDELSKLPNIIQVTKIAD
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaaatacagaagcgtttttgatattatcggcccggttatgatcggtccgtccagctct
catacagcgggagctgctagaatcgggagagtggccagaagtttatttggcagagagcct
gagcgcatcattgtatctttttacggctcgtttgcggaaacgtataagggccacggcaca
gatgtcgcgattatcggcggattgcttgattttgatacattcgatgaacggattaaaacc
gctatacaaattgcagaagctaaaggaattgatatagagtttcgggtagaagacgcagtc
ccggtccacccgaacacagcaaaaatcaccatttctgatgaaaagggtgagctggaactg
acgggtatttcgattggcggaggaaagattgaaatcacagaattgaatggttttgagctc
cggctgtcaggaaatcatccggccatattagttgttcataatgacaagtttggcacaatt
gccggtgttgccaatgttctggcgaaattttcaatcaacgtaggacatatggaagtagcc
cggaaagatatcggccagcttgcgctgatgacaatagaggtcgatcaaaatattgacgac
cacattctcgacgagctgtcgaagctgccgaatattattcaagtgacaaagattgctgac
tag

DBGET integrated database retrieval system