KEGG   Bacillus subtilis subsp. subtilis 168: BSU15860
Entry
BSU15860          CDS       T00010                                 

Symbol
sdaAA
Name
(RefSeq) L-serine dehydratase, alpha chain
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU15860 (sdaAA)
   00270 Cysteine and methionine metabolism
    BSU15860 (sdaAA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     BSU15860 (sdaAA)
SSDB
Motif
Pfam: SDH_alpha FlgN
Other DBs
NCBI-GeneID: 937109
NCBI-ProteinID: NP_389468
Pasteur: BG13398
BSORF: BG13398
UniProt: O34607 A0A6M4JIQ9
Position
1658930..1659832
AA seq 300 aa
MFRNVKELIEITKEKQILISDVMIAQEMEVTEKTKEDIFQQMDHNLSVMEAAVQKGLEGV
TSQTGLTGGDAVKLQAYIRSGKSLSGPLILDAVSKAVATNEVNAAMGTICATPTAGSAGV
VPGTLFAVKEKLNPTREQMIRFLFTAGAFGFVVANNASISGAAGGCQAEVGSASGMAAAA
IVEMAGGTPEQSAEAMAITLKNMLGLVCDPVAGLVEVPCVKRNAMGASNAMIAADMALAG
ITSRIPCDEVIDAMYKIGQTMPTALRETGQGGLAATPTGRELEKKIFGGALGSRETTSAN
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtttcgtaatgtaaaagaattaattgagattactaaagaaaaacaaatattgatctct
gatgtgatgatagctcaagagatggaagtaacagaaaaaacaaaagaggacatttttcag
cagatggatcataacctgtctgttatggaagcggcggttcagaaaggactcgagggagtt
acgagccaaacgggcttaacaggcggagatgccgttaaattgcaggcctatattcgatca
ggaaaaagcctgtctggcccgctgattttagatgctgtatcgaaagccgttgcaacaaat
gaagtaaatgcagccatgggaaccatctgtgcgacaccgactgcaggttctgccggtgtg
gtgcccggtacgttatttgctgtaaaagaaaagctgaatccaacaagagaacaaatgatc
cgctttttgtttacagccggggctttcggatttgtcgtggccaataacgcaagcatttcc
ggcgccgccggaggatgtcaggcagaggttggatcagcttcaggcatggcggctgcggct
attgttgaaatggcaggaggaacacccgaacaaagcgcggaagccatggccattacatta
aaaaatatgctaggcctcgtgtgcgaccctgttgcagggcttgttgaggtgccttgcgtg
aaacggaatgcgatgggcgcgtcaaatgcgatgattgctgctgatatggcattggcgggc
attacaagccgtattccatgtgatgaggttatcgatgccatgtataaaataggccaaacg
atgccaactgcacttagagaaacaggccagggcggtttagcggcaacaccgacaggaaga
gaattagagaaaaaaattttcggaggagcgctaggttcacgtgaaacaacatcagcaaac
tag

DBGET integrated database retrieval system