KEGG   Bacillus subtilis subsp. subtilis 168: BSU15880
Entry
BSU15880          CDS       T00010                                 

Gene name
ylpC
Definition
(RefSeq) transcription factor FapR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: 4HBT HTH_11 MaoC_dehydratas HTH_DeoR MaoC_dehydrat_N HTH_24
Other DBs
NCBI-GeneID: 936595
NCBI-ProteinID: NP_389470
Pasteur: BG13400
BSORF: BG13400
UniProt: O34835 A0A6M3ZAP6
Structure
PDB: 
2F41 2F3X

Position
1661967..1662533
AA seq 188 aa
MRRNKRERQELLQQTIQATPFITDEELAGKFGVSIQTIRLDRLELSIPELRERIKNVAEK
TLEDEVKSLSLDEVIGEIIDLELDDQAISILEIKQEHVFSRNQIARGHHLFAQANSLAVA
VIDDELALTASADIRFTRQVKQGERVVAKAKVTAVEKEKGRTVVEVNSYVGEEIVFSGRF
DMYRSKHS
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagaagaaataagagagaacgccaggaattacttcagcagacgattcaagcaaccccc
tttattacagatgaagaactagcgggtaaattcggggtgagcatccagacgatacgtttg
gaccgcttagagctttccatacctgaactgagagaaagaattaagaacgtggcagagaaa
acacttgaggacgaagtgaagtccctgtcacttgatgaagttatcggagaaattattgac
cttgagctggatgatcaggcgatatccattttagaaataaaacaggagcacgtgttcagc
cggaatcagattgcgagaggacaccatttatttgcacaggcgaattctttggccgttgca
gtcattgatgacgagctggcgctgactgcaagtgcagacatccgctttacaagacaggta
aagcagggtgaacgtgtcgtagcaaaagcgaaagtgacggctgtcgaaaaagaaaaagga
agaacggttgtcgaagtgaacagctacgttggcgaagaaattgttttttctggacgcttt
gacatgtatcgttcaaaacattcataa

DBGET integrated database retrieval system