KEGG   Bacillus subtilis subsp. subtilis 168: BSU15890
Entry
BSU15890          CDS       T00010                                 

Symbol
plsX
Name
(RefSeq) phosphate acyltransferase
  KO
K03621  phosphate acyltransferase [EC:2.3.1.274]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00561  Glycerolipid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU15890 (plsX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU15890 (plsX)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.274  phosphate acyltransferase
     BSU15890 (plsX)
Lipid biosynthesis proteins [BR:bsu01004]
 Phospholipid acyltransferase
  GPAT
   BSU15890 (plsX)
SSDB
Motif
Pfam: FA_synthesis
Other DBs
NCBI-GeneID: 938066
NCBI-ProteinID: NP_389471
Pasteur: BG11843
BSORF: BG11843
UniProt: P71018 A0A6M3ZE81
Structure
PDB: 
6A1K 1VI1

Position
1662547..1663548
AA seq 333 aa
MRIAVDAMGGDHAPKAVIDGVIKGIEAFDDLHITLVGDKTTIESHLTTTSDRITVLHADE
VIEPTDEPVRAVRRKKNSSMVLMAQEVAENRADACISAGNTGALMTAGLFIVGRIKGIDR
PALAPTLPTVSGDGFLLLDVGANVDAKPEHLVQYAIMGSVYSQQVRGVTSPRVGLLNVGT
EDKKGNELTKQTFQILKETANINFIGNVEARDLLDDVADVVVTDGFTGNVTLKTLEGSAL
SIFKMMRDVMTSTLTSKLAAAVLKPKLKEMKMKMEYSNYGGASLFGLKAPVIKAHGSSDS
NAVFHAIRQAREMVSQNVAALIQEEVKEEKTDE
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagaatagctgtagatgcaatgggaggagaccacgctcccaaagctgttattgacgga
gttataaaaggtatagaggcatttgatgatctccatatcacacttgtcggtgacaaaaca
acgatagaatcacatttaacaactacatcagatcgcatcacggtgctgcacgcagatgaa
gtgattgagcctacggatgaaccggtccgtgccgtgcgaagaaaaaagaactcatctatg
gttcttatggcgcaggaggttgcggaaaacagagctgacgcctgcatttcagcgggaaat
accggtgcattaatgacagccggtctctttattgtcgggagaattaaaggaattgaccgt
ccggcgcttgctccgacacttccgactgtttcgggagacggatttcttctccttgatgtc
ggcgccaatgtcgatgccaaaccggagcacctcgttcaatatgccatcatgggttctgtt
tattctcagcaagtgcgcggtgtcacttcaccgagagtcggacttttaaatgtcggaaca
gaagataaaaaaggaaacgaactgacgaagcagacgtttcaaattttaaaagaaacagca
aacatcaattttatcggaaacgtggaagcgcgagaccttttagatgatgtggcggatgtt
gtagtaacagacggctttaccgggaatgttacactcaaaacgctggaaggctctgcgttg
tcaatttttaaaatgatgagagacgtaatgacgtctactttgacatccaagcttgcagca
gctgtgctgaaaccaaaattgaaagaaatgaaaatgaaaatggagtattcgaattatggc
ggagcaagtctttttggcttaaaagcgcctgtgatcaaggcgcacggctcttcagattca
aatgctgtattccatgcgattcggcaagcaagagagatggtcagccaaaatgtggctgcg
ctcattcaggaagaagtgaaagaagaaaaaacagatgagtag

DBGET integrated database retrieval system