KEGG   Bacillus subtilis subsp. subtilis 168: BSU15900
Entry
BSU15900          CDS       T00010                                 

Symbol
fabD
Name
(RefSeq) malonyl CoA-acyl carrier protein transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01212  Fatty acid metabolism
Module
bsu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU15900 (fabD)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BSU15900 (fabD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU15900 (fabD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     BSU15900 (fabD)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU15900 (fabD)
SSDB
Motif
Pfam: Acyl_transf_1 SAT
Other DBs
NCBI-GeneID: 938488
NCBI-ProteinID: NP_389472
Pasteur: BG11836
BSORF: BG11836
UniProt: P71019 A0A6M3ZB03
Position
1663567..1664520
AA seq 317 aa
MSKIAFLFPGQGSQFIGMGKELYEQVPAAKRLFDEADETLETKLSSLIFEGDAEELTLTY
NAQPALLTTSIAVLEKFKESGITPDFTAGHSLGEYSALVAAGALSFKDAVYTVRKRGEFM
NEAVPAGEGAMAAILGMDAEALKQVTDKVTEEGNLVQLANLNCPGQIVISGTAKGVELAS
ELAKENGAKRAIPLEVSGPFHSELMKPAAEKLKEVLDACDIKDADVPVISNVSADVMTEK
ADIKEKLIEQLYSPVRFEESINKLIAEGVTTFIEIGPGKVLSGLVKKVNRRLKTIAVSDP
ETIELAIQTLKEENDNA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagtaagattgcatttttattcccgggtcagggatcacaatttatcggcatgggaaaa
gagctttatgagcaggtgcctgctgcaaagcgtctgtttgatgaagccgatgaaacgttg
gaaacaaaactcagctcgcttatttttgagggggatgctgaagaattaacacttacatac
aatgcgcagcctgctttgcttacgacaagcatcgctgttcttgagaaatttaaagaatct
ggcattacacctgatttcacagcaggacacagccttggtgaatattctgcactggttgcg
gctggcgctctgtctttcaaagatgctgtttatactgtcagaaagcgcggagagtttatg
aatgaagcggtgccggctggcgaaggagcaatggctgcgattctcggcatggatgctgaa
gcattaaagcaagtaaccgataaagtcacagaggaaggcaaccttgtacagcttgcgaat
ctcaactgtcctggccaaatcgtcatttccggaacagctaaaggggttgagcttgcatct
gaactggcaaaagagaacggcgcaaaacgcgcaattccgcttgaagtaagcggtccgttc
cattctgaactgatgaaaccggctgctgaaaagctgaaagaggtattggacgcctgtgac
ataaaagacgctgacgttccggtcatctcaaatgtttctgctgacgtgatgactgaaaaa
gcagatatcaaagaaaaacttattgagcagctttactctccggttcgttttgaggaaagc
attaacaagctgatcgcagagggtgttacgacttttattgaaatcggtcccggaaaagtg
ctttcaggccttgtgaaaaaagtgaatagacggttaaaaacaattgctgtatcagatccg
gaaacgatcgagctggcaattcaaacgcttaaggaggagaatgataatgcttaa

DBGET integrated database retrieval system