KEGG   Bacillus subtilis subsp. subtilis 168: BSU15910
Entry
BSU15910          CDS       T00010                                 

Symbol
fabG
Name
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01212  Fatty acid metabolism
bsu01240  Biosynthesis of cofactors
Module
bsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU15910 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU15910 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BSU15910 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU15910 (fabG)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     BSU15910 (fabG)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU15910 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase DUF460 Polysacc_synt_2 Cullin
Other DBs
NCBI-GeneID: 938113
NCBI-ProteinID: NP_389473
Pasteur: BG11535
BSORF: BG11535
UniProt: P51831 A0A6M4JMX5
Position
1664513..1665253
AA seq 246 aa
MLNDKTAIVTGASRGIGRSIALDLAKSGANVVVNYSGNEAKANEVVDEIKSMGRKAIAVK
ADVSNPEDVQNMIKETLSVFSTIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNC
TKAVTRQMMKQRSGRIINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVN
AIAPGFISTDMTDKLAKDVQDEMLKQIPLARFGEPSDVSSVVTFLASEGARYMTGQTLHI
DGGMVM
NT seq 741 nt   +upstreamnt  +downstreamnt
atgcttaatgataaaacggctattgtcactggcgcatcccgcggaatcggccgctcaatc
gcccttgatctggcaaaaagcggagcaaatgttgtcgtgaactactccggcaatgaagcg
aaagcaaatgaagtggtagatgaaatcaaatcaatgggcagaaaagcaattgctgtaaaa
gcggatgtatcaaatcccgaagatgtacaaaacatgataaaagaaacattgtctgttttt
tctacgattgacattctggttaataatgcgggaattacaagagacaatctcatcatgaga
atgaaagaagacgaatgggatgacgtcattaacattaacctgaagggtgttttcaactgc
acaaaagctgttacaagacaaatgatgaaacagcgttcaggccgcattattaacgtatcg
tctatcgtcggcgtcagcggaaaccctggacaagccaactacgtggctgcaaaagccggc
gtcatcggtttaaccaaatcttctgctaaagagctcgccagccgaaatattacggtaaac
gcaatagcgccaggatttatctcaactgatatgacagataaacttgcaaaagacgttcaa
gacgaaatgctgaaacaaattccgctcgcgcgctttggtgaacctagcgatgtcagcagt
gttgtcacgttcctagcttcagagggagctcgttatatgacaggccaaacgcttcatatt
gacggcggaatggtgatgtaa

DBGET integrated database retrieval system