KEGG   Bacillus subtilis subsp. subtilis 168: BSU15930
Entry
BSU15930          CDS       T00010                                 

Symbol
rnc
Name
(RefSeq) ribonuclease 3
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU15930 (rnc)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU15930 (rnc)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15930 (rnc)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     BSU15930 (rnc)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     BSU15930 (rnc)
Ribosome biogenesis [BR:bsu03009]
 Eukaryotic type
  90S particles
   RNase
    BSU15930 (rnc)
 Prokaryotic type
  rRNA processing factors
   BSU15930 (rnc)
Chromosome and associated proteins [BR:bsu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     BSU15930 (rnc)
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm Phage_P2_GpU DND1_DSRM
Other DBs
NCBI-GeneID: 936169
NCBI-ProteinID: NP_389475
Pasteur: BG11537
BSORF: BG11537
UniProt: P51833 A0A6M3ZB29
Position
1665710..1666459
AA seq 249 aa
MSKHSHYKDKKKFYKKVEQFKEFQERISVHFQNEKLLYQAFTHSSYVNEHRKKPYEDNER
LEFLGDAVLELTISRFLFAKYPAMSEGDLTKLRAAIVCEPSLVSLAHELSFGDLVLLGKG
EEMTGGRKRPALLADVFEAFIGALYLDQGLEPVESFLKVYVFPKINDGAFSHVMDFKSQL
QEYVQRDGKGSLEYKISNEKGPAHNREFEAIVSLKGEPLGVGNGRSKKEAEQHAAQEALA
KLQKHHTKQ
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtcaaaacactcacattataaagataaaaaaaagttctataaaaaagtagaacaattt
aaagagtttcaagaacggatttcggttcactttcaaaatgaaaagcttttgtatcaagca
tttacacattcatcttatgtgaatgagcatcggaaaaagccgtatgaagataatgaaagg
cttgaatttttaggtgacgctgttttggaactgacgatctccagattcttatttgccaaa
tacccggctatgagtgaaggagatttgacgaaattgagagccgcaattgtttgcgaaccg
tctctcgtttcattggctcacgagctgtcattcggcgatcttgtcctgttgggtaaaggc
gaggaaatgacaggcggaagaaagcgtcctgctctattggcggatgtttttgaggcattt
atcggagccttgtaccttgaccaaggattagagccggtcgaaagtttcttaaaagtttat
gtgttccctaaaattaacgatggtgctttttctcatgtgatggatttcaaaagccagctg
caggaatacgtgcagcgggacggcaaaggctctctggagtataaaatctccaacgaaaaa
ggacctgcgcacaaccgtgaatttgaagccatcgtatctctaaaaggtgaaccactcgga
gtcggaaacggccgttcaaagaaagaagccgaacagcacgctgctcaggaagctttagct
aaattgcaaaaacaccatacgaaacaataa

DBGET integrated database retrieval system