KEGG   Bacillus subtilis subsp. subtilis 168: BSU15940
Entry
BSU15940          CDS       T00010                                 

Symbol
smc
Name
(RefSeq) chromosome partition protein Smc
  KO
K03529  chromosome segregation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15940 (smc)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    BSU15940 (smc)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_21 AAA_15 AAA_29 DUF2647 ABC_tran
Other DBs
NCBI-GeneID: 938085
NCBI-ProteinID: NP_389476
Pasteur: BG11538
BSORF: BG11538
UniProt: P51834 A0A6M3ZAX9
Structure
PDB: 

Position
1666560..1670120
AA seq 1186 aa
MFLKRLDVIGFKSFAERISVDFVKGVTAVVGPNGSGKSNITDAIRWVLGEQSARSLRGGK
MEDIIFAGSDSRKRLNLAEVTLTLDNDDHFLPIDFHEVSVTRRVYRSGESEFLINNQPCR
LKDIIDLFMDSGLGKEAFSIISQGKVEEILSSKAEDRRSIFEEAAGVLKYKTRKKKAENK
LFETQDNLNRVEDILHELEGQVEPLKIQASIAKDYLEKKKELEHVEIALTAYDIEELHGK
WSTLKEKVQMAKEEELAESSAISAKEAKIEDTRDKIQALDESVDELQQVLLVTSEELEKL
EGRKEVLKERKKNAVQNQEQLEEAIVQFQQKETVLKEELSKQEAVFETLQAEVKQLRAQV
KEKQQALSLHNENVEEKIEQLKSDYFELLNSQASIRNELQLLDDQMSQSAVTLQRLADNN
EKHLQERHDISARKAACETEFARIEQEIHSQVGAYRDMQTKYEQKKRQYEKNESALYQAY
QYVQQARSKKDMLETMQGDFSGFYQGVKEVLKAKERLGGIRGAVLELISTEQKYETAIEI
ALGASAQHVVTDDEQSARKAIQYLKQNSFGRATFLPLSVIRDRQLQSRDAETAARHSSFL
GVASELVTFDPAYRSVIQNLLGTVLITEDLKGANELAKLLGHRYRIVTLEGDVVNPGGSM
TGGAVKKKNNSLLGRSRELEDVTKRLAEMEEKTALLEQEVKTLKHSIQDMEKKLADLRET
GEGLRLKQQDVKGQLYELQVAEKNINTHLELYDQEKSALSESDEERKVRKRKLEEELSAV
SEKMKQLEEDIDRLTKQKQTQSSTKESLSNELTELKIAAAKKEQACKGEEDNLARLKKEL
TETELALKEAKEDLSFLTSEMSSSTSGEEKLEEAAKHKLNDKTKTIELIALRRDQRIKLQ
HGLDTYERELKEMKRLYKQKTTLLKDEEVKLGRMEVELDNLLQYLREEYSLSFEGAKEKY
QLETDPEEARKRVKLIKLAIEELGTVNLGSIDEFERVNERYKFLSEQKEDLTEAKNTLFQ
VIEEMDEEMTKRFNDTFVQIRSHFDQVFRSLFGGGRAELRLTDPNDLLHSGVEIIAQPPG
KKLQNLNLLSGGERALTAIALLFSILKVRPVPFCVLDEVEAALDEANVFRFAQYLKKYSS
DTQFIVITHRKGTMEEADVLYGVTMQESGVSKVISVKLEETKEFVQ
NT seq 3561 nt   +upstreamnt  +downstreamnt
atgttcctcaaacgtttagacgttataggatttaaatcatttgcagaacggatttccgta
gacttcgttaaaggcgtgacagcagttgtcgggccgaacggaagcggaaaaagcaacatc
acggatgccattcgctgggttctcggcgaacaatcggcacgctctcttcgcggcggaaaa
atggaagacatcatttttgctgggagtgattcaagaaagcgattaaatctagctgaagtt
acgcttactcttgataatgatgatcatttcttgccaattgacttccacgaggtgagtgtc
acaagacgtgtgtacagatcaggtgagagtgagtttctgattaacaatcagccatgccgc
ttgaaagatattattgatttatttatggactctgggcttggtaaagaagcattttctatt
atcagccaagggaaagtggaagagatcctgagcagcaaagcggaggatcgccgcagtatc
tttgaagaagcggccggggtgcttaaatataaaacgagaaagaaaaaagcagaaaataaa
ctgtttgagacacaggacaatctaaatcgggtagaagatatattacatgagcttgaagga
caggttgaacctcttaaaattcaagcttcaatagcgaaagactaccttgagaaaaagaaa
gagctggagcatgttgaaattgcgctgactgcctatgatatcgaagagctgcatggtaaa
tggtcgactcttaaagagaaagtgcagatggcaaaagaagaagagcttgctgaatcgtct
gctatttctgcgaaagaagcaaagattgaggatacaagggacaaaatacaagcgcttgat
gagtcagtagatgagctccagcaagttttactggtaactagtgaagagctggaaaagctt
gaaggccgtaaagaagtcctgaaagaacgaaagaaaaacgctgtgcaaaaccaagaacag
cttgaagaagccatcgttcagttccagcaaaaagaaacggttctgaaagaagagctttcg
aagcaggaagctgtcttcgaaacgcttcaggctgaggtgaagcagttaagggcgcaagta
aaagaaaaacagcaggctctcagtcttcacaatgaaaatgtcgaagagaaaatcgagcag
ctgaaaagtgattattttgagctgttaaacagccaggcttcgatacgcaacgaactccag
cttcttgatgaccagatgtcccaatccgctgtcacattgcagagacttgcggacaacaat
gaaaagcacctgcaggaacggcatgatatttctgcgcgtaaagccgcatgtgaaacggaa
tttgcccgaattgagcaggagattcacagtcaagtcggtgcatatcgtgatatgcagaca
aaatatgagcagaaaaagcgccaatacgaaaaaaatgaatccgctctgtatcaggcatac
caatacgttcagcaagcgagatcaaaaaaggacatgcttgagacgatgcagggagatttc
tccggcttttatcaaggtgttaaagaagtgctgaaagcgaaagagcgccttggcggaatt
cgcggagcggttcttgagctgatttctacagaacagaagtatgaaacggccattgaaata
gcgctcggcgcttctgctcaacacgtcgtgaccgacgatgaacaatctgcccgcaaagcg
attcaatatttaaagcagaattccttcggccgggcgacgtttctgcctctttctgttatt
agagaccgccagcttcaaagccgtgacgcggaaacagccgcccggcattcatcatttctc
ggggttgccagtgaacttgtcacatttgatcctgcgtatcgaagcgtcatccagaatctt
cttggaaccgttctgatcacagaggacttaaagggtgcaaacgagcttgcgaagcttctc
gggcaccggtaccgcatcgtaacccttgagggagatgttgtgaaccccggtggttcaatg
acgggcggcgcggttaaaaagaaaaataactccctccttggaagaagccgggagctagaa
gatgtgacgaaacggctcgctgaaatggaagagaaaacggcactgcttgaacaagaggtc
aaaacccttaagcactccattcaggatatggagaaaaaactggctgacttaagagaaacc
ggggaaggcttaaggttaaagcagcaggatgtgaaaggccagctgtacgaacttcaagtt
gccgagaaaaatatcaatacccatttagagctctatgatcaagaaaaatctgctctgtca
gaaagcgatgaagagagaaaagtgcgcaaacgcaagcttgaagaagagctctctgccgta
tctgaaaagatgaaacagcttgaagaggacatagacagactgacaaaacaaaaacaaacg
caatcctcaacgaaagagtctctctccaacgagctgactgagctgaagatcgcagcggcc
aaaaaagagcaggcttgcaagggggaagaggacaaccttgccagattaaagaaagagctc
actgaaacagagcttgcgttaaaagaagcaaaagaagacttaagcttcttaacgtcagag
atgtcatctagcaccagcggcgaagaaaagctggaagaagcagcaaaacataaattgaat
gacaaaacgaaaacgatcgaactgattgcattaaggcgcgatcagcgcatcaagcttcag
catgggcttgatacgtatgagcgtgagctgaaagaaatgaaacgcctgtataaacaaaaa
acaacgctcttaaaagacgaagaagtcaaacttggacgaatggaagtcgagcttgataat
ttactccaatacttacgggaggaatacagcttgtcctttgagggggcaaaagagaaatat
cagcttgaaactgatccagaggaagccagaaagcgcgtgaagctgattaaactcgcaatt
gaagagctgggtaccgtgaacctcggaagcatagatgagtttgagagggtcaacgaacgg
tacaagtttctgtcggaacaaaaagaagatttaacagaagcgaaaaataccttgttccaa
gtgattgaagaaatggatgaagaaatgacgaagcgctttaacgacacattcgtccaaatc
cgctcacactttgatcaagttttccgctccttattcggaggagggcgagctgaactgagg
ctcaccgatcctaacgatctgcttcattcaggagtcgagattatcgctcagccgccgggg
aaaaagctgcaaaacttaaacctcctgtcaggcggagagcgtgcgcttactgctatagcg
ctcttattctcaatcctaaaggttcgtccagtgccgttttgcgtccttgacgaagtagag
gctgcgctcgacgaagcgaatgtgttccgatttgcgcagtatttaaaaaaatacagcagc
gatactcagtttattgtgattacccacagaaaaggaacgatggaggaagcggatgtgctt
tatggcgtaaccatgcaggaatccggtgtttccaaggtaatttcagttaagctggaagaa
acaaaagaattcgttcagtaa

DBGET integrated database retrieval system