KEGG   Bacillus subtilis subsp. subtilis 168: BSU15960
Entry
BSU15960          CDS       T00010                                 

Symbol
ylqB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Big_1 CarboxypepD_reg MG4 Invasin_D3 MG2 DUF4198 CooC_C YtkA CarbopepD_reg_2 Dioxygenase_C BIg21 Pollen_Ole_e_1 TTR-52
Other DBs
NCBI-GeneID: 938179
NCBI-ProteinID: NP_389478
Pasteur: BG13401
BSORF: BG13401
UniProt: O31737 A0A6M3ZAQ0
Position
complement(1671166..1671651)
AA seq 161 aa
MKKIGLLFMLCLAALFTIGFPAQQADAAEAPYKASITNISTDGGVYGKINYGQGQYWRVK
YNITVSGKLLDQNGQPVPNAPVRFEADTKVGNTTQTASGTTDANGTFEVPMYLGPAAGYY
TYYTSVSVHYYDIIPFRVFSGESRLVSTDNSLYHFAYQVRR
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaaaaaaatcggtttattgtttatgttatgtctggcagccctgtttacaataggtttc
ccggcacagcaagcagacgctgctgaggcaccttataaggcctcaatcacaaatatcagc
acagatggaggggtatacggtaaaatcaattacggacaaggtcaatattggcgagtcaag
tacaatattacagtaagcggcaaattactcgaccaaaacggacagccagtgccaaacgcg
cccgtaagatttgaagcggacacgaaggtcggaaacacaacacaaactgcttcaggaacg
actgatgcaaacggaacatttgaggttccaatgtatttggggccagctgctggttactat
acgtattacacatctgtttccgttcattactatgacatcatcccattcagagttttttct
ggtgagtcaagactggtatccactgataacagcctttatcatttcgcctatcaagtaaga
agataa

DBGET integrated database retrieval system