KEGG   Bacillus subtilis subsp. subtilis 168: BSU15970
Entry
BSU15970          CDS       T00010                                 

Symbol
ylxM
Name
(RefSeq) hypothetical protein
  KO
K09787  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU15970 (ylxM)
SSDB
Motif
Pfam: UPF0122 Sigma70_r4 HTH_11 Sigma70_r4_2 HTH_23 HTH_28 IIGP Mga HTH_Tnp_1_2 Phage_antitermQ Sigma70_ECF HTH_29 DNA_topoisoIV
Other DBs
NCBI-GeneID: 937995
NCBI-ProteinID: NP_389479
Pasteur: BG10829
BSORF: BG10829
UniProt: P37104 A0A6M3ZAM1
Position
1671828..1672160
AA seq 110 aa
MSLEKTTRMNYLFDFYQSLLTSKQKSYMSLYYLDDFSLGEIAEEYEVSRQAVYDNIKRTE
AMLEQYEEKLLLLKKFQERKEMFNKLKELASGSKEEEEITALIEALEKLD
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtcactcgaaaagacaacgagaatgaattatctgtttgatttttatcagtcgttgttg
acgtcaaaacagaagagctatatgtcgctttattatttggacgatttctccctaggcgaa
atagccgaagaatatgaggtttcaagacaagctgtttatgataacatcaaacgaacagaa
gcaatgcttgaacaatatgaagaaaagctgctccttttgaaaaagtttcaggagcgtaaa
gagatgtttaataagctgaaggagcttgcttccggttcaaaagaagaggaagaaattaca
gctctgattgaagcgcttgagaaattagattag

DBGET integrated database retrieval system